BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00503 (334 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 20 6.8 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 20 6.8 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 20.2 bits (40), Expect = 6.8 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +2 Query: 101 NAFVSSVRKQVVNIPSFIVRLDSGKHIDFSLKS 199 +A V+ RK N+ + + KHIDF S Sbjct: 20 SAAVNHQRKSANNLAHSMKVIYEWKHIDFDFGS 52 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 20.2 bits (40), Expect = 6.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 253 SLAEVLPLDTSRTTSTEW 200 SL V+ LDT++ EW Sbjct: 11 SLVSVVLLDTTQEEKLEW 28 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,224 Number of Sequences: 438 Number of extensions: 1125 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7466580 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -