BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00500X (443 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48723| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.99 SB_47891| Best HMM Match : RVT_1 (HMM E-Value=1.3e-09) 30 0.99 SB_34554| Best HMM Match : RVT_1 (HMM E-Value=0.2) 30 0.99 SB_29557| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.99 SB_29228| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.99 SB_23509| Best HMM Match : XET_C (HMM E-Value=3.6) 30 0.99 SB_43286| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.99 SB_2750| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.99 SB_2226| Best HMM Match : RVT_1 (HMM E-Value=4.6e-09) 30 0.99 SB_54156| Best HMM Match : Peptidase_C2 (HMM E-Value=0) 29 2.3 SB_51930| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.0 SB_1905| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_1158| Best HMM Match : Toxin_24 (HMM E-Value=0.57) 27 5.3 SB_32860| Best HMM Match : Lipase_GDSL (HMM E-Value=1.1) 27 5.3 SB_21299| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.0 >SB_48723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 29.9 bits (64), Expect = 0.99 Identities = 20/58 (34%), Positives = 31/58 (53%) Frame = +3 Query: 66 LFSDTSVPNFLHPGDWMIKLNISQGYFSSIGRKISSILLEGQYQGTSISTFREGSGPS 239 LFS S+P D +K I Q F G +++ +LEG+YQ T +S + G+ P+ Sbjct: 93 LFSSPSLPVDARVSD-KLKAKIWQNEFVEFGLLLANPILEGKYQLT-LSASQNGAMPA 148 >SB_47891| Best HMM Match : RVT_1 (HMM E-Value=1.3e-09) Length = 969 Score = 29.9 bits (64), Expect = 0.99 Identities = 20/58 (34%), Positives = 31/58 (53%) Frame = +3 Query: 66 LFSDTSVPNFLHPGDWMIKLNISQGYFSSIGRKISSILLEGQYQGTSISTFREGSGPS 239 LFS S+P D +K I Q F G +++ +LEG+YQ T +S + G+ P+ Sbjct: 171 LFSSPSLPVDARVSD-KLKAKIWQNEFVEFGLLLANPILEGKYQLT-LSASQNGAMPA 226 >SB_34554| Best HMM Match : RVT_1 (HMM E-Value=0.2) Length = 671 Score = 29.9 bits (64), Expect = 0.99 Identities = 20/58 (34%), Positives = 31/58 (53%) Frame = +3 Query: 66 LFSDTSVPNFLHPGDWMIKLNISQGYFSSIGRKISSILLEGQYQGTSISTFREGSGPS 239 LFS S+P D +K I Q F G +++ +LEG+YQ T +S + G+ P+ Sbjct: 62 LFSSPSLPVDARVSD-KLKAKIWQNEFVEFGLLLANPILEGKYQLT-LSASQNGAMPA 117 >SB_29557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 29.9 bits (64), Expect = 0.99 Identities = 20/58 (34%), Positives = 31/58 (53%) Frame = +3 Query: 66 LFSDTSVPNFLHPGDWMIKLNISQGYFSSIGRKISSILLEGQYQGTSISTFREGSGPS 239 LFS S+P D +K I Q F G +++ +LEG+YQ T +S + G+ P+ Sbjct: 134 LFSSPSLPVDARVSD-KLKAKIWQNEFVEFGLLLANPILEGKYQLT-LSASQNGAMPA 189 >SB_29228| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 29.9 bits (64), Expect = 0.99 Identities = 20/58 (34%), Positives = 31/58 (53%) Frame = +3 Query: 66 LFSDTSVPNFLHPGDWMIKLNISQGYFSSIGRKISSILLEGQYQGTSISTFREGSGPS 239 LFS S+P D +K I Q F G +++ +LEG+YQ T +S + G+ P+ Sbjct: 134 LFSSPSLPVDARVSD-KLKAKIWQNEFVEFGLLLANPILEGKYQLT-LSASQNGAMPA 189 >SB_23509| Best HMM Match : XET_C (HMM E-Value=3.6) Length = 362 Score = 29.9 bits (64), Expect = 0.99 Identities = 20/58 (34%), Positives = 31/58 (53%) Frame = +3 Query: 66 LFSDTSVPNFLHPGDWMIKLNISQGYFSSIGRKISSILLEGQYQGTSISTFREGSGPS 239 LFS S+P D +K I Q F G +++ +LEG+YQ T +S + G+ P+ Sbjct: 134 LFSSPSLPVDARVSD-KLKAKIWQNEFVEFGLLLANPILEGKYQLT-LSASQNGAMPA 189 >SB_43286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 477 Score = 29.9 bits (64), Expect = 0.99 Identities = 20/58 (34%), Positives = 31/58 (53%) Frame = +3 Query: 66 LFSDTSVPNFLHPGDWMIKLNISQGYFSSIGRKISSILLEGQYQGTSISTFREGSGPS 239 LFS S+P D +K I Q F G +++ +LEG+YQ T +S + G+ P+ Sbjct: 171 LFSSPSLPVDARVSD-KLKAKIWQNEFVEFGLLLANPILEGKYQLT-LSASQNGAMPA 226 >SB_2750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 29.9 bits (64), Expect = 0.99 Identities = 20/58 (34%), Positives = 31/58 (53%) Frame = +3 Query: 66 LFSDTSVPNFLHPGDWMIKLNISQGYFSSIGRKISSILLEGQYQGTSISTFREGSGPS 239 LFS S+P D +K I Q F G +++ +LEG+YQ T +S + G+ P+ Sbjct: 171 LFSSPSLPVDARVSD-KLKAKIWQNEFVEFGLLLANPILEGKYQLT-LSASQNGAMPA 226 >SB_2226| Best HMM Match : RVT_1 (HMM E-Value=4.6e-09) Length = 944 Score = 29.9 bits (64), Expect = 0.99 Identities = 20/58 (34%), Positives = 31/58 (53%) Frame = +3 Query: 66 LFSDTSVPNFLHPGDWMIKLNISQGYFSSIGRKISSILLEGQYQGTSISTFREGSGPS 239 LFS S+P D +K I Q F G +++ +LEG+YQ T +S + G+ P+ Sbjct: 171 LFSSPSLPVDARVSD-KLKAKIWQNEFVEFGLLLANPILEGKYQLT-LSASQNGAMPA 226 >SB_54156| Best HMM Match : Peptidase_C2 (HMM E-Value=0) Length = 1001 Score = 28.7 bits (61), Expect = 2.3 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = -3 Query: 378 KGSRLVDTSTGVPFARKVSATRML*KQKGVALKPAR 271 +GS +DTSTG PF+ +S TR L +Q V+++ R Sbjct: 380 QGSSDLDTSTGSPFS--MSPTRALQRQASVSVETRR 413 >SB_51930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 28.3 bits (60), Expect = 3.0 Identities = 20/58 (34%), Positives = 30/58 (51%) Frame = +3 Query: 66 LFSDTSVPNFLHPGDWMIKLNISQGYFSSIGRKISSILLEGQYQGTSISTFREGSGPS 239 LFS S+P D +K I Q F G +++ +LEG+YQ T +S ++G S Sbjct: 134 LFSSPSLPVDARVSD-KLKAKIWQNEFVEFGLLLANPILEGKYQLT-LSASQKGGHAS 189 >SB_1905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 27.5 bits (58), Expect = 5.3 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = +3 Query: 66 LFSDTSVPNFLHPGDWMIKLNISQGYFSSIGRKISSILLEGQYQGT 203 LFS S+P D +K I Q F G +++ +LEG+YQ T Sbjct: 134 LFSSPSLPVDARVSD-KLKAKIWQNEFVEFGLLLANPILEGKYQLT 178 >SB_1158| Best HMM Match : Toxin_24 (HMM E-Value=0.57) Length = 497 Score = 27.5 bits (58), Expect = 5.3 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -2 Query: 337 CTQGLCDPHVIEAKRCG 287 C+ LC+P+ EA+RCG Sbjct: 19 CSGKLCEPNEFEARRCG 35 >SB_32860| Best HMM Match : Lipase_GDSL (HMM E-Value=1.1) Length = 263 Score = 27.5 bits (58), Expect = 5.3 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +3 Query: 117 IKLNISQGYFSSIGRKISSILLEGQYQGTSISTFREGSGPS 239 +K I Q F G +++ +LEG+YQ T +S + GS P+ Sbjct: 145 LKAKIWQNEFVEFGLLLANPILEGKYQLT-LSASKNGSMPA 184 >SB_21299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2630 Score = 27.1 bits (57), Expect = 7.0 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = -2 Query: 325 LCDPHVIEAKRCGSEASPRGRHVIHTNS 242 +C PH++ A+ G + S GR ++ N+ Sbjct: 231 VCRPHIVRARLVGGKTSTEGRVELYYNN 258 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,284,559 Number of Sequences: 59808 Number of extensions: 296530 Number of successful extensions: 719 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 692 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 719 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 871599479 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -