BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00500X (443 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-128|AAM68338.1| 1209|Drosophila melanogaster CG14471-PB... 31 0.71 >AE013599-128|AAM68338.1| 1209|Drosophila melanogaster CG14471-PB, isoform B protein. Length = 1209 Score = 31.1 bits (67), Expect = 0.71 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = -3 Query: 147 KNIPEKCSILSSSPLGGESLVPRCPKTVRCFIFTTLFNSRKSKIGRI 7 +++P CS S S++ + P T +CF T+L ++K K R+ Sbjct: 1150 RSLPAACSASCSHTCAHLSVIDQSPATTKCFGKTSLTTAKKGKSRRL 1196 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,747,587 Number of Sequences: 53049 Number of extensions: 440532 Number of successful extensions: 899 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 878 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 899 length of database: 24,988,368 effective HSP length: 78 effective length of database: 20,850,546 effective search space used: 1438687674 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -