Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS00500X
         (443 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE013599-128|AAM68338.1| 1209|Drosophila melanogaster CG14471-PB...    31   0.71 

>AE013599-128|AAM68338.1| 1209|Drosophila melanogaster CG14471-PB,
            isoform B protein.
          Length = 1209

 Score = 31.1 bits (67), Expect = 0.71
 Identities = 14/47 (29%), Positives = 25/47 (53%)
 Frame = -3

Query: 147  KNIPEKCSILSSSPLGGESLVPRCPKTVRCFIFTTLFNSRKSKIGRI 7
            +++P  CS   S      S++ + P T +CF  T+L  ++K K  R+
Sbjct: 1150 RSLPAACSASCSHTCAHLSVIDQSPATTKCFGKTSLTTAKKGKSRRL 1196


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,747,587
Number of Sequences: 53049
Number of extensions: 440532
Number of successful extensions: 899
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 878
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 899
length of database: 24,988,368
effective HSP length: 78
effective length of database: 20,850,546
effective search space used: 1438687674
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)