BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00499 (767 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 4.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 4.7 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 21 8.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.2 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 21 8.2 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 4.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = -1 Query: 239 LGPSYKSGQVTSWLNALTNGKVLWPLLEEIFTIFL 135 + + K G + + A + V+WPL+E T++L Sbjct: 211 INENLKMGLDIASITAQASSFVVWPLVENNPTLYL 245 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 4.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = -1 Query: 239 LGPSYKSGQVTSWLNALTNGKVLWPLLEEIFTIFL 135 + + K G + + A + V+WPL+E T++L Sbjct: 211 INENLKMGLDIASITAQASSFVVWPLVENNPTLYL 245 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 21.4 bits (43), Expect = 8.2 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +3 Query: 558 VLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCLALTNVESG 689 VLF+ + +GV Y ++ G+SR + + T LAL ++ G Sbjct: 33 VLFVIIVAGNVGVLYTLLFGRSRKSRMNY--FITHLALADLSVG 74 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 274 ASSESAPSDQPIYPD 318 ASS APS P+ PD Sbjct: 2288 ASSTMAPSTTPMVPD 2302 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 21.4 bits (43), Expect = 8.2 Identities = 16/50 (32%), Positives = 19/50 (38%) Frame = -3 Query: 693 GHQTPHLLELSMCMSCGVQVHRGGTCP*QCSMVRPFYGITLAGKGPAQWD 544 G TP E S V G P + ++ FYG T PAQ D Sbjct: 224 GADTPWQREYENVNSTVVNWVNAGADPGKLTIGLAFYGHTFQLADPAQHD 273 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,815 Number of Sequences: 336 Number of extensions: 3688 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20650031 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -