BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00498 (737 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC29B12.02c |set2||histone lysine methyltransferase Set2 |Schi... 30 0.40 SPAC25G10.03 |zip1||transcription factor Zip1|Schizosaccharomyce... 26 4.9 SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosacch... 26 6.4 SPBC691.01 |||palmitoyltransferase |Schizosaccharomyces pombe|ch... 26 6.4 >SPAC29B12.02c |set2||histone lysine methyltransferase Set2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 798 Score = 29.9 bits (64), Expect = 0.40 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 527 KYEKPSPLEVDQ*QQTKTDIISY-YVDTLIRTGDSAVQNPADAP 655 K EK P E+ QQ K + ++ Y+DT++ +A P D+P Sbjct: 745 KKEKALPDELSDSQQRKLRVWAFRYLDTVVSRSGTATTTPTDSP 788 >SPAC25G10.03 |zip1||transcription factor Zip1|Schizosaccharomyces pombe|chr 1|||Manual Length = 330 Score = 26.2 bits (55), Expect = 4.9 Identities = 18/72 (25%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Frame = +2 Query: 515 RYRKKYEKPSPLEVDQ*QQTKTDIISY-YVDTLIRTGDSAVQNPADAPHSNVDIDALIRK 691 + K ++ +P ++ QQ K + +S + L TG+ + NPA + +D+ L+ Sbjct: 70 KQEKNVQQQNPEKISTLQQVKEEEVSNTFSAPLNATGNFSSANPASIDLAYLDLQKLLTL 129 Query: 692 PYYYIPLQS*TS 727 P + Q TS Sbjct: 130 PDHSKETQEKTS 141 >SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 2609 Score = 25.8 bits (54), Expect = 6.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 588 IISVLVCCY*STSKGEGFSY 529 + S+L C Y + G+GFSY Sbjct: 1266 LFSILTCIYNRITSGQGFSY 1285 >SPBC691.01 |||palmitoyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 312 Score = 25.8 bits (54), Expect = 6.4 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -2 Query: 508 DTCTSNNKFF*EYRYRFYVTRNKCIV 431 D C SN KFF Y++ FY C+V Sbjct: 149 DVCFSNQKFF--YQFLFYGFSAACMV 172 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,845,124 Number of Sequences: 5004 Number of extensions: 55543 Number of successful extensions: 108 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 108 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 349251756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -