BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00497X (574 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0621 + 4574426-4574657,4574751-4574852,4575637-4575908,457... 29 3.5 02_01_0041 + 279583-281622,281724-282047,282315-282443,282526-28... 29 3.5 01_01_0855 - 6666854-6666969,6667107-6667230,6667679-6667849,666... 28 6.1 09_06_0085 - 20760072-20761085 27 8.0 07_01_0594 + 4428440-4429837 27 8.0 03_04_0112 - 17375871-17376099,17377021-17377054,17377237-173774... 27 8.0 >03_01_0621 + 4574426-4574657,4574751-4574852,4575637-4575908, 4576207-4576395 Length = 264 Score = 28.7 bits (61), Expect = 3.5 Identities = 17/57 (29%), Positives = 24/57 (42%) Frame = -1 Query: 538 TGNTSSTYPYLSPDAILTPSLDQYTFSGCGYPSTSQGRLSSAPAVSVGGADNILVDT 368 T + + YP LSP+ + P Y + P S S+PA V A +DT Sbjct: 26 TASDYAHYPRLSPEDVAPPPPPSYHAAASSAPPYSGNPYVSSPAGGVAPASKNTMDT 82 >02_01_0041 + 279583-281622,281724-282047,282315-282443,282526-282648, 282768-282923,283224-283349,283426-283560,283815-283942, 284037-284148,284233-284547,284655-284771,284871-285166, 285252-285783,287980-288082,288808-288881,288965-289062, 289340-289380,289977-290032,290170-290244,290377-290469, 290602-290850,290930-291002,291681-291766,291853-291938, 292067-292142,292280-292347,292430-292496,292570-292665, 292741-292843,293214-293309,293396-293466 Length = 2047 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +3 Query: 360 TAPVSTRILSAPPTLTAGAELSLPCEVDGYPQPENVYWSKDGVRIASG 503 ++P T S PP A L +P + YP +N+ +G ++SG Sbjct: 1398 SSPAETSFSSPPPATQFSAPLMVPT-IQRYPSMDNITTPNNGSGLSSG 1444 >01_01_0855 - 6666854-6666969,6667107-6667230,6667679-6667849, 6668171-6668276,6668356-6668532,6669213-6669442 Length = 307 Score = 27.9 bits (59), Expect = 6.1 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 4/47 (8%) Frame = -1 Query: 505 SPDAILTPSLDQYTFSG----CGYPSTSQGRLSSAPAVSVGGADNIL 377 SPD + S YT++G C + S G S+PA+SVG + N++ Sbjct: 143 SPDG--SSSFTAYTYAGELPTCAFGFNSNGVRVSSPAMSVGHSYNLM 187 >09_06_0085 - 20760072-20761085 Length = 337 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +1 Query: 148 GEGSPATLLMEVRA-YKQDDTPSDNKYLVSRPGE 246 GE + +++EVR + DD P +YLV + GE Sbjct: 152 GETASEVVILEVRTEFGHDDPPEFGRYLVEQLGE 185 >07_01_0594 + 4428440-4429837 Length = 465 Score = 27.5 bits (58), Expect = 8.0 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = -1 Query: 211 RAYRLVCTPEPPSVTWPGFLLRCMLDTRIPRAPRRSVVLLE-ERFLWLRTMYCCMAPWD 38 R + P S+ W + L +DT A ++VL+ ER W + MY C WD Sbjct: 320 RVDKFADAPRRESIRWARWWLA--VDTASSSAGGGALVLVATERRWWKQKMYMCAFRWD 376 >03_04_0112 - 17375871-17376099,17377021-17377054,17377237-17377470, 17377636-17377705 Length = 188 Score = 27.5 bits (58), Expect = 8.0 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = -1 Query: 487 TPSLDQYTFSGCGYPSTSQGRLSSAPAVSVGGADNILVDTGAVNRGT 347 T S +FSGC +PS++ ++ + VG L G + GT Sbjct: 95 TLSSSDPSFSGCTFPSSASAAGTTGLSPGVGTGTGTLSPGGGIGTGT 141 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,962,872 Number of Sequences: 37544 Number of extensions: 291467 Number of successful extensions: 1107 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1083 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1106 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1328870592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -