BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00493X (622 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000015FE3 Cluster: Homolog of Homo sapiens "Contact... 33 7.3 >UniRef50_UPI0000015FE3 Cluster: Homolog of Homo sapiens "Contactin associated protein 1 precursor; n=1; Takifugu rubripes|Rep: Homolog of Homo sapiens "Contactin associated protein 1 precursor - Takifugu rubripes Length = 1202 Score = 32.7 bits (71), Expect = 7.3 Identities = 23/80 (28%), Positives = 39/80 (48%), Gaps = 4/80 (5%) Frame = +3 Query: 294 HYSIAYDNINSVHLLLLKHPPSGDIFTCEYK*G----FISIKYNSVYSLNVRLILIAQQL 461 H +I + + +LL GD+FT E K G IS+ + ++ ++ R+ L A L Sbjct: 176 HIAINFKTLEQDGVLLHSEGIQGDLFTLELKRGRLYLHISLGSSVIHKVDGRITLSAGSL 235 Query: 462 IFHIKIKYHWQYVNIVKLQR 521 + ++ HW YV I + R Sbjct: 236 LDNL----HWHYVTIKRYGR 251 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 533,602,183 Number of Sequences: 1657284 Number of extensions: 9775764 Number of successful extensions: 19231 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 18664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19223 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 45221970467 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -