BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00493X (622 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1952.12c |csn71|csn7a, csn7|COP9/signalosome complex subunit... 31 0.18 SPBC29A3.14c |trt1||telomerase reverse transcriptase 1 protein T... 27 2.2 SPBC27B12.04c |||conserved eukaryotic protein|Schizosaccharomyce... 26 5.1 >SPAC1952.12c |csn71|csn7a, csn7|COP9/signalosome complex subunit 7a|Schizosaccharomyces pombe|chr 1|||Manual Length = 205 Score = 30.7 bits (66), Expect = 0.18 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +3 Query: 210 LQEASLKFSRISQTHLNCV-LVSINNISVHYSIAYDNINSVHLLLLKHPPSGDIFTCEY 383 +++AS +++ + L + L+ + N V S++++ I VHL L + PPS FT EY Sbjct: 49 IRDASSEWNELRFKKLRLLTLIDLANRHVGSSVSFETI-LVHLQLDRLPPSDPTFTVEY 106 >SPBC29A3.14c |trt1||telomerase reverse transcriptase 1 protein Trt1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 988 Score = 27.1 bits (57), Expect = 2.2 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +1 Query: 166 SLIIELKKHYIKLQFYKRLRSSFRGF 243 S +EL KH K FYK LRSS F Sbjct: 828 STSVELTKHMGKSFFYKILRSSLASF 853 >SPBC27B12.04c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 817 Score = 25.8 bits (54), Expect = 5.1 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +3 Query: 393 FISIKYNSVYSLNVRLILIAQQLIFHIKIKYHWQYV 500 F+S Y+ ++ I +A QL +HI K + YV Sbjct: 444 FVSQSYDDLFPYMDNFIQLAVQLFYHISKKVNCLYV 479 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,329,892 Number of Sequences: 5004 Number of extensions: 45131 Number of successful extensions: 89 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 273658928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -