BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00493X (622 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_3585| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_54195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_1848| Best HMM Match : Galactosyl_T (HMM E-Value=1.4e-26) 27 9.3 SB_52114| Best HMM Match : Galactosyl_T (HMM E-Value=3.5e-25) 27 9.3 SB_34298| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 >SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5445 Score = 28.3 bits (60), Expect = 5.3 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = -1 Query: 442 ISLTFREY-TELYLIEINPYLYSQVKISPEGGCFNSKRCTELILSYAIE 299 IS F E E + + N ++S VK C N +CTE+I + E Sbjct: 2558 ISRNFSELPNENVISKANQTVWSVVKPCESNPCMNEAKCTEMIRDFQCE 2606 >SB_3585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1117 Score = 27.9 bits (59), Expect = 7.0 Identities = 9/41 (21%), Positives = 20/41 (48%) Frame = +3 Query: 228 KFSRISQTHLNCVLVSINNISVHYSIAYDNINSVHLLLLKH 350 +++ + +H C + ++ Y+I YD ++ VH H Sbjct: 969 RYTMFTHSHTACYTMHYYTLTTRYTIQYDTVHHVHASYNSH 1009 >SB_54195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 306 AYDNINSVHLLLLKHPPSGDIFTCEYK*GFISIKY 410 A DN + L+ + GD+ T EY+ GF ++ Y Sbjct: 108 ANDNQEEMRLMAAEDRLYGDLITSEYREGFFNMSY 142 >SB_1848| Best HMM Match : Galactosyl_T (HMM E-Value=1.4e-26) Length = 308 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 306 AYDNINSVHLLLLKHPPSGDIFTCEYK*GFISIKY 410 A DN + L+ + GD+ T EY+ GF ++ Y Sbjct: 104 ANDNQEEMRLMAAEDRLYGDLITSEYREGFFNMSY 138 >SB_52114| Best HMM Match : Galactosyl_T (HMM E-Value=3.5e-25) Length = 383 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 306 AYDNINSVHLLLLKHPPSGDIFTCEYK*GFISIKY 410 A DN + L+ + GD+ T EY+ GF ++ Y Sbjct: 179 ANDNQEEMRLMAAEDRLYGDLITSEYREGFFNMSY 213 >SB_34298| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 27.5 bits (58), Expect = 9.3 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 398 NKSLFIFTSKNITRRW 351 N+SLFIF+ KNI RR+ Sbjct: 49 NRSLFIFSEKNIIRRF 64 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,537,189 Number of Sequences: 59808 Number of extensions: 307457 Number of successful extensions: 646 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 587 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 646 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1536271375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -