BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00491 (538 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 23 1.5 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 23 1.5 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 23 2.6 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 4.6 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 23.4 bits (48), Expect = 1.5 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 386 SCCPWCC 406 SCC WCC Sbjct: 10 SCCCWCC 16 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 23.4 bits (48), Expect = 1.5 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +1 Query: 85 KDYHAPKHTELEKI--PNLQVIKAMQSLKSRGYVKEQ 189 KD P + KI PN+ +IK L G V E+ Sbjct: 242 KDAKVPIIVAINKIDKPNIDIIKVQYELAKHGIVIEE 278 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 22.6 bits (46), Expect = 2.6 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -2 Query: 267 QEEGEEYSQVFNTLIG*VP 211 + E E +++VFNTL+ VP Sbjct: 234 ETETETWTRVFNTLVDLVP 252 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.8 bits (44), Expect = 4.6 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = +3 Query: 324 PVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADV 431 P R P+R R RRTP V+ D+ + + Sbjct: 394 PPPRQTPPSRKESGRRRRRRTPRYNSVSKIDRASRI 429 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,207 Number of Sequences: 438 Number of extensions: 2399 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15213684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -