BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00490 (837 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 28 0.11 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 22 6.9 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 27.9 bits (59), Expect = 0.11 Identities = 11/47 (23%), Positives = 25/47 (53%) Frame = +3 Query: 42 KSAKPYKKYDPLILKTAIEAYEIEKKSLVEIAKQFNISKSVLHRHVT 182 + KPY DP + ++A ++ + L+E+ K + + HR+++ Sbjct: 131 RQEKPYYIADPEVDSLMVQAIQVLRFHLLELEKVHELCDNFCHRYIS 177 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 21.8 bits (44), Expect = 6.9 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = -1 Query: 717 CKGAQLCTQRSKATGYHQ 664 CK Q C SK G HQ Sbjct: 87 CKRQQYCQLMSKLLGNHQ 104 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,323 Number of Sequences: 336 Number of extensions: 4268 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23036718 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -