SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS00490
         (837 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_03_1267 + 25318220-25318407,25318674-25318844,25319086-253191...    28   8.0  

>07_03_1267 +
           25318220-25318407,25318674-25318844,25319086-25319188,
           25319394-25319885,25320723-25321156,25321333-25321388,
           25321711-25321775,25322139-25322147
          Length = 505

 Score = 28.3 bits (60), Expect = 8.0
 Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%)
 Frame = +2

Query: 254 YVCSEWGYPLDSYDLRMIIKRYIDRIGIKINRFTNNLPGVNY-IENFLKRHHQEISPRIS 430
           +VCS  GY  D   L     R   RIG          P   Y + +F   H+ +++P  +
Sbjct: 222 FVCSREGYNRDKKSLEAKKPRLDTRIGCPARLIIKVTPESKYRVTDFKADHNHQLAPPST 281

Query: 431 QNIKRCRAALS 463
            ++ R +  L+
Sbjct: 282 MHMLRSQRILT 292


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,370,748
Number of Sequences: 37544
Number of extensions: 385744
Number of successful extensions: 832
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 821
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 832
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2315199948
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -