BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00482 (323 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g60245.1 68416.m06733 60S ribosomal protein L37a (RPL37aC) 115 8e-27 At3g10950.1 68416.m01320 60S ribosomal protein L37a (RPL37aB) si... 108 1e-24 At2g32770.3 68415.m04011 purple acid phosphatase (PAP13) identic... 28 1.2 At2g32770.2 68415.m04012 purple acid phosphatase (PAP13) identic... 28 1.2 At2g32770.1 68415.m04010 purple acid phosphatase (PAP13) identic... 28 1.2 At4g28730.1 68417.m04109 glutaredoxin family protein contains gl... 27 2.2 At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiqui... 27 3.8 At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiqui... 27 3.8 At5g58930.1 68418.m07382 expressed protein contains Pfam PF05340... 25 8.8 At3g18290.1 68416.m02326 zinc finger protein-related weak alignm... 25 8.8 At1g23740.1 68414.m02996 oxidoreductase, zinc-binding dehydrogen... 25 8.8 >At3g60245.1 68416.m06733 60S ribosomal protein L37a (RPL37aC) Length = 92 Score = 115 bits (276), Expect = 8e-27 Identities = 49/69 (71%), Positives = 56/69 (81%) Frame = +1 Query: 16 MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 195 MAKRTKKVGI GKYGTRYGAS+RK +KKMEV+QH+KY C FCGK +KR VGIW CK C Sbjct: 1 MAKRTKKVGIVGKYGTRYGASIRKQIKKMEVSQHSKYFCEFCGKYGVKRKAVGIWGCKDC 60 Query: 196 KRTVAGGAW 222 + AGGA+ Sbjct: 61 GKVKAGGAY 69 >At3g10950.1 68416.m01320 60S ribosomal protein L37a (RPL37aB) similar to putative 60S ribosomal protein L37a GB:AAD28753 [Gossypium hirsutum] Length = 92 Score = 108 bits (259), Expect = 1e-24 Identities = 47/69 (68%), Positives = 53/69 (76%) Frame = +1 Query: 16 MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 195 M KRTKK I GKYGTRYGASLRK +KKMEV+QH KY C FCGK ++KR VGIW CK C Sbjct: 1 MTKRTKKARIVGKYGTRYGASLRKQIKKMEVSQHNKYFCEFCGKYSVKRKVVGIWGCKDC 60 Query: 196 KRTVAGGAW 222 + AGGA+ Sbjct: 61 GKVKAGGAY 69 >At2g32770.3 68415.m04011 purple acid phosphatase (PAP13) identical to purple acid phosphatase (PAP13) [Arabidopsis thaliana] GI:20257489; contains Pfam profile PF00149: Ser/Thr protein phosphatase Length = 545 Score = 28.3 bits (60), Expect = 1.2 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +3 Query: 9 YQNGQTYQKGWNYW 50 Y +G+TYQ W+YW Sbjct: 264 YSSGETYQPRWDYW 277 >At2g32770.2 68415.m04012 purple acid phosphatase (PAP13) identical to purple acid phosphatase (PAP13) [Arabidopsis thaliana] GI:20257489; contains Pfam profile PF00149: Ser/Thr protein phosphatase Length = 428 Score = 28.3 bits (60), Expect = 1.2 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +3 Query: 9 YQNGQTYQKGWNYW 50 Y +G+TYQ W+YW Sbjct: 183 YSSGETYQPRWDYW 196 >At2g32770.1 68415.m04010 purple acid phosphatase (PAP13) identical to purple acid phosphatase (PAP13) [Arabidopsis thaliana] GI:20257489; contains Pfam profile PF00149: Ser/Thr protein phosphatase Length = 516 Score = 28.3 bits (60), Expect = 1.2 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +3 Query: 9 YQNGQTYQKGWNYW 50 Y +G+TYQ W+YW Sbjct: 264 YSSGETYQPRWDYW 277 >At4g28730.1 68417.m04109 glutaredoxin family protein contains glutaredoxin domain, Pfam:PF00462 Length = 174 Score = 27.5 bits (58), Expect = 2.2 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 46 TGKYGTRYGASLRKMVKKMEVTQHAKYTCSFC 141 + +G+R S+RK V + V ++K CS+C Sbjct: 62 SSSFGSRMEESIRKTVTENTVVIYSKTWCSYC 93 >At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiquitin-transferase family protein similar to SP|Q14669Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 1794 Score = 26.6 bits (56), Expect = 3.8 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -1 Query: 221 QAPPATVLLHRLQDQMPTQERF 156 + PP TVL+ +LQ+ + + ERF Sbjct: 802 KVPPMTVLIQKLQNALSSLERF 823 >At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiquitin-transferase family protein similar to SP|Q14669Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 1888 Score = 26.6 bits (56), Expect = 3.8 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -1 Query: 221 QAPPATVLLHRLQDQMPTQERF 156 + PP TVL+ +LQ+ + + ERF Sbjct: 875 KVPPMTVLIQKLQNALSSLERF 896 >At5g58930.1 68418.m07382 expressed protein contains Pfam PF05340: Protein of unknown function (DUF740) Length = 521 Score = 25.4 bits (53), Expect = 8.8 Identities = 6/13 (46%), Positives = 11/13 (84%) Frame = +3 Query: 12 QNGQTYQKGWNYW 50 ++G+ + KGWN+W Sbjct: 347 KSGKNWSKGWNFW 359 >At3g18290.1 68416.m02326 zinc finger protein-related weak alignment to Pfam profiles: PF00097 Zinc finger, C3HC4 type (RING finger) (2 copies) Length = 1254 Score = 25.4 bits (53), Expect = 8.8 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = -1 Query: 230 ENTQAPPATVLLHRLQDQMPTQERFIASLPQNEQVYFACWVTS 102 E Q P + + ++Q RF+ S+P N F W++S Sbjct: 177 EQKQVFPLLIEKFKYEEQAYIVWRFLCSIPVNMLAVFLPWISS 219 >At1g23740.1 68414.m02996 oxidoreductase, zinc-binding dehydrogenase family protein contains Pfam profile PF00107: oxidoreductase, zinc-binding dehydrogenase family Length = 386 Score = 25.4 bits (53), Expect = 8.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 210 RRSLGILHYCCLIMQSAVRRLREVK 284 RR +LHYC L +S V ++ V+ Sbjct: 16 RRETPLLHYCSLTTKSPVYQINRVR 40 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,685,933 Number of Sequences: 28952 Number of extensions: 129711 Number of successful extensions: 376 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 372 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 376 length of database: 12,070,560 effective HSP length: 71 effective length of database: 10,014,968 effective search space used: 360538848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -