BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00477 (432 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50387| Best HMM Match : HLH (HMM E-Value=8.2e-05) 30 0.71 SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) 29 2.2 SB_15233| Best HMM Match : fn3 (HMM E-Value=1.1e-15) 28 3.8 SB_43934| Best HMM Match : Band_41 (HMM E-Value=1.2e-15) 27 5.0 SB_42271| Best HMM Match : DUF229 (HMM E-Value=0) 27 5.0 SB_38160| Best HMM Match : Toxin_29 (HMM E-Value=3.7) 27 6.6 SB_19263| Best HMM Match : TAP42 (HMM E-Value=0.25) 27 6.6 >SB_50387| Best HMM Match : HLH (HMM E-Value=8.2e-05) Length = 791 Score = 30.3 bits (65), Expect = 0.71 Identities = 12/40 (30%), Positives = 27/40 (67%) Frame = +3 Query: 168 SRARFQLSGNSGRKHSRCCTSILRKFSGRSIVSQLTAAAM 287 +++ FQ++G +G++ + C ++R+F G + SQL+ A+ Sbjct: 129 AKSFFQVNGKNGQEET--CEDLVREFEGNGLFSQLSLEAL 166 >SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 203 Score = 28.7 bits (61), Expect = 2.2 Identities = 13/51 (25%), Positives = 25/51 (49%) Frame = +3 Query: 123 CCNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILRKFSGRSIVSQLT 275 C ++H G+++ I + R Q+ G+ R C TS+ ++ R+ T Sbjct: 6 CATVFHDGAMNPIEVIKQRLQMYGSPYRGVIHCATSVFKEEGIRAFYRSYT 56 >SB_15233| Best HMM Match : fn3 (HMM E-Value=1.1e-15) Length = 594 Score = 27.9 bits (59), Expect = 3.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 135 WHWGSVDSISGSRARFQLSGNSGRKHSR 218 WH S +S++G R R+ +S S H+R Sbjct: 20 WHCYSEESLTGDRRRYNISKQSTLYHTR 47 >SB_43934| Best HMM Match : Band_41 (HMM E-Value=1.2e-15) Length = 378 Score = 27.5 bits (58), Expect = 5.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 135 WHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILR 239 + W VDSI+ S+A+F S + H T LR Sbjct: 265 YEWPLVDSITASKAKFYFSCATNENHKEQGTVCLR 299 >SB_42271| Best HMM Match : DUF229 (HMM E-Value=0) Length = 591 Score = 27.5 bits (58), Expect = 5.0 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -3 Query: 430 FFFFFTSHRQIY*KFKC--ILIPNKTEKVRSW 341 FFF+F R+++ KC + I N T+ RSW Sbjct: 141 FFFYFKEARRVFENRKCSVVEIINFTDITRSW 172 >SB_38160| Best HMM Match : Toxin_29 (HMM E-Value=3.7) Length = 534 Score = 27.1 bits (57), Expect = 6.6 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -3 Query: 175 AREPL-MESTDPQCHILQHRRPRLPLMQLEAPCSFNFCSLRAI 50 +REP S PQ H+L +R L + ++ CS CS+ I Sbjct: 57 SREPFDSRSKLPQKHLLNSKRRALAIAKILLACSPEHCSMSFI 99 >SB_19263| Best HMM Match : TAP42 (HMM E-Value=0.25) Length = 303 Score = 27.1 bits (57), Expect = 6.6 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 370 PNKTEKVRSWSDVENG*CLASPHGVGATMAAA 275 P K +K R W D ++G C + +G T+AAA Sbjct: 167 PEKLQKARDWDDWKDGLCGVA---IGYTVAAA 195 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,924,248 Number of Sequences: 59808 Number of extensions: 243481 Number of successful extensions: 481 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 472 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 481 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 822495283 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -