BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00473 (592 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 25 0.48 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 23 1.9 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 25.0 bits (52), Expect = 0.48 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 Query: 8 STHY*SFICQHSCDCFVQHRLPTKICGHCYPM 103 S H I Q SC +Q L KI H YP+ Sbjct: 135 SIHLRGAIGQRSCQVVIQCYLEIKIDEHLYPV 166 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 23.0 bits (47), Expect = 1.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 181 FPVTSAGMLWLICSSTV 231 F V G +WL+ SSTV Sbjct: 489 FLVNDFGFIWLVLSSTV 505 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,441 Number of Sequences: 336 Number of extensions: 2741 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14830622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -