BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00470 (696 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC25A8.03c ||SPAC3C7.15c|DUF185 protein|Schizosaccharomyces po... 27 1.9 SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharo... 27 3.4 >SPAC25A8.03c ||SPAC3C7.15c|DUF185 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 467 Score = 27.5 bits (58), Expect = 1.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -2 Query: 197 FYLPSNSNSRNLKTPLLHNNY 135 F++P +S+NLK P NNY Sbjct: 436 FFVPVEPSSKNLKVPYSFNNY 456 >SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 1811 Score = 26.6 bits (56), Expect = 3.4 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 175 IQEILRLHCSIITMVSLGHFGLTASIINNYYIKFIT 68 I+ +L L C+I + SLGH ++ + YI I+ Sbjct: 1316 IENLLVLQCAISVVSSLGHEHISCVLTQGAYIDLIS 1351 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,493,348 Number of Sequences: 5004 Number of extensions: 45651 Number of successful extensions: 75 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -