BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00470 (696 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U64844-11|AAB18311.1| 482|Caenorhabditis elegans Hypothetical p... 28 5.5 >U64844-11|AAB18311.1| 482|Caenorhabditis elegans Hypothetical protein T22F3.8 protein. Length = 482 Score = 28.3 bits (60), Expect = 5.5 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 6/43 (13%) Frame = -3 Query: 175 IQEILRLHCSIITMVSL------GHFGLTASIINNYYIKFITV 65 IQ + LHC T +L G GLT ++NNYY +FI + Sbjct: 3 IQTLFTLHCLYRTFFNLKVAFFLGSAGLTMMLLNNYY-RFIVL 44 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,691,469 Number of Sequences: 27780 Number of extensions: 250334 Number of successful extensions: 487 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 476 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 487 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1602927856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -