BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00469 (560 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) 138 4e-33 SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) 122 2e-28 SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) 106 1e-23 SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) 99 3e-21 SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) 32 0.28 SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.28 SB_35674| Best HMM Match : SH2 (HMM E-Value=0) 32 0.28 SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 31 0.49 SB_26151| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.64 SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) 31 0.64 SB_57319| Best HMM Match : Pox_A_type_inc (HMM E-Value=6.3e-06) 31 0.64 SB_15994| Best HMM Match : Pox_A_type_inc (HMM E-Value=2e-06) 31 0.64 SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) 31 0.64 SB_45987| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 30 1.1 SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) 30 1.1 SB_40528| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_12462| Best HMM Match : Kinesin (HMM E-Value=0) 30 1.1 SB_42014| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.083) 30 1.5 SB_23940| Best HMM Match : MuDR (HMM E-Value=0.24) 30 1.5 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 30 1.5 SB_52390| Best HMM Match : Cauli_DNA-bind (HMM E-Value=6.4) 30 1.5 SB_40368| Best HMM Match : SASP_gamma (HMM E-Value=2.3) 30 1.5 SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 29 2.0 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) 24 2.5 SB_3809| Best HMM Match : DUF1014 (HMM E-Value=8.7e-09) 29 2.6 SB_1024| Best HMM Match : Ank (HMM E-Value=0) 29 2.6 SB_59386| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_33252| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_6748| Best HMM Match : Pkinase (HMM E-Value=1.7e-05) 29 3.4 SB_54892| Best HMM Match : DHH (HMM E-Value=0.057) 28 4.5 SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) 28 4.5 SB_32331| Best HMM Match : DivIVA (HMM E-Value=0.86) 28 4.5 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) 28 4.5 SB_47601| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_40334| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_32124| Best HMM Match : K-box (HMM E-Value=4.1) 28 6.0 SB_31911| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_3206| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00047) 28 6.0 SB_3000| Best HMM Match : Extensin_2 (HMM E-Value=0.058) 28 6.0 SB_2140| Best HMM Match : DUF1154 (HMM E-Value=1) 28 6.0 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 28 6.0 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 28 6.0 SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) 28 6.0 SB_11244| Best HMM Match : M (HMM E-Value=2.5e-08) 28 6.0 SB_33413| Best HMM Match : DUF81 (HMM E-Value=0.31) 27 7.9 SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) 27 7.9 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 27 7.9 SB_18255| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_8591| Best HMM Match : DUF601 (HMM E-Value=0.23) 27 7.9 SB_3240| Best HMM Match : Sec8_exocyst (HMM E-Value=0.48) 27 7.9 >SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1097 Score = 138 bits (333), Expect = 4e-33 Identities = 60/84 (71%), Positives = 75/84 (89%) Frame = +2 Query: 2 ENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 181 ENKITITNDKGRLSKE+IERMVNEA KY+ ED+KQ++ IQ KN+LESY +SMKST+ED+K Sbjct: 500 ENKITITNDKGRLSKEDIERMVNEASKYKEEDEKQRDRIQTKNSLESYAYSMKSTVEDDK 559 Query: 182 LKEKISDSDKQTILDKCNDTIKWL 253 +K+KIS+ DK+ ILDKC + +KWL Sbjct: 560 VKDKISEEDKKAILDKCTEVLKWL 583 Score = 51.2 bits (117), Expect = 6e-07 Identities = 20/30 (66%), Positives = 27/30 (90%) Frame = +1 Query: 256 SNQLADKEEYEHKQKELEGICNPIITKMYQ 345 +NQ A+K+E+E+ QKELE +CNPIITK+YQ Sbjct: 585 TNQTAEKDEFEYHQKELEKVCNPIITKLYQ 614 >SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 122 bits (295), Expect = 2e-28 Identities = 53/84 (63%), Positives = 71/84 (84%) Frame = +2 Query: 2 ENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 181 ENKITITNDKGRLSKE+IERMV EAEK++ D+ +E IQ+KN+LESY FSMKSTMEDEK Sbjct: 592 ENKITITNDKGRLSKEDIERMVKEAEKFKAADEAVRERIQSKNSLESYAFSMKSTMEDEK 651 Query: 182 LKEKISDSDKQTILDKCNDTIKWL 253 +K+K+S+ +++ ++ +C T+ WL Sbjct: 652 VKDKLSEDEREKVISRCKATLDWL 675 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = +1 Query: 259 NQLADKEEYEHKQKELEGICNPIITKMYQ 345 NQ A+KEE + QKELEG+CNPIITK+YQ Sbjct: 678 NQSAEKEEIDAHQKELEGVCNPIITKLYQ 706 >SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) Length = 640 Score = 106 bits (254), Expect = 1e-23 Identities = 46/81 (56%), Positives = 63/81 (77%) Frame = +2 Query: 11 ITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKE 190 ITITNDKGRLSKEEI+RM+N+AEKY++ED+ Q+E I A+N LESY F +KS + + L+ Sbjct: 502 ITITNDKGRLSKEEIDRMINDAEKYKSEDEAQREKIAARNRLESYAFGVKSAISEPSLEG 561 Query: 191 KISDSDKQTILDKCNDTIKWL 253 K+S SDK T+ +K + + WL Sbjct: 562 KLSQSDKDTVKNKVEEVLNWL 582 Score = 39.9 bits (89), Expect = 0.001 Identities = 14/28 (50%), Positives = 24/28 (85%) Frame = +1 Query: 259 NQLADKEEYEHKQKELEGICNPIITKMY 342 N LA+KEE+E ++KEL+ +C+PI+ K++ Sbjct: 585 NSLAEKEEFEEQEKELQRVCSPIMAKVH 612 >SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1327 Score = 98.7 bits (235), Expect = 3e-21 Identities = 46/104 (44%), Positives = 68/104 (65%), Gaps = 1/104 (0%) Frame = +2 Query: 2 ENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMED-E 178 + KITITND+ RL+ E+IERMVN+AEK+ +ED K KE ++A+N LESY +S+K+ + D E Sbjct: 1193 KEKITITNDQNRLTPEDIERMVNDAEKFADEDKKTKEKVEARNELESYAYSLKNQVGDKE 1252 Query: 179 KLKEKISDSDKQTILDKCNDTIKWLVPTNWPTRRSMSTSRKNWK 310 KL K+S+ DK+TI + I W+ + ++ WK Sbjct: 1253 KLGGKLSEDDKKTITEAVEKAISWMDKNQDASVEDFKKEKRKWK 1296 >SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 42.3 bits (95), Expect = 3e-04 Identities = 26/102 (25%), Positives = 49/102 (48%), Gaps = 1/102 (0%) Frame = +2 Query: 2 ENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 181 E+K ++ K++ + E + DD + +AKNALES+ F ++ M E Sbjct: 679 ESKSEGKKEEPTADKDKKAEKADGKEAPKARDDAKAANERAKNALESHIFGVRDEMNSE- 737 Query: 182 LKEKIS-DSDKQTILDKCNDTIKWLVPTNWPTRRSMSTSRKN 304 L EK+S +++++TI + WL W + ++ + N Sbjct: 738 LGEKLSTEAERETISEALTAASDWLDEDGWDSTANVYNEKLN 779 >SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 766 Score = 36.7 bits (81), Expect = 0.013 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 2/75 (2%) Frame = +2 Query: 2 ENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESY--CFSMKSTMED 175 E +I I + G LSK+ IE M+ EAEKY E DKQK+ + K + + K Sbjct: 304 EQQIVIQSSGG-LSKDAIENMIKEAEKYA-EADKQKKVEKLKEEIAKVREVLANKDNETG 361 Query: 176 EKLKEKISDSDKQTI 220 E +++ S+ ++++ Sbjct: 362 ETIRQAYSELQQKSL 376 >SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) Length = 552 Score = 32.3 bits (70), Expect = 0.28 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = +2 Query: 77 EKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIK 247 E+ D QKE QA +E Y S++ E KE + S+K+ + ++C + IK Sbjct: 13 EESTRAGDLQKEVTQASENIEKYSQSIRDLGE----KENVLTSEKKQLEEECQENIK 65 >SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1789 Score = 32.3 bits (70), Expect = 0.28 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 5/77 (6%) Frame = +2 Query: 26 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQA-KNALES---YCFSMKSTMEDEKLKEK 193 DKG K++ E ++ E +++ + +KE Q+ K ES C S K E EK E+ Sbjct: 1526 DKGESEKDKGESEKDKGESEKDKGESEKEKCQSEKEKCESEKEKCESEKEKCESEKKVEE 1585 Query: 194 ISDSD-KQTILDKCNDT 241 D + ++ I +K +DT Sbjct: 1586 SKDENPEEKIEEKKDDT 1602 >SB_35674| Best HMM Match : SH2 (HMM E-Value=0) Length = 871 Score = 32.3 bits (70), Expect = 0.28 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 5/77 (6%) Frame = +2 Query: 26 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQA-KNALES---YCFSMKSTMEDEKLKEK 193 DKG K++ E ++ E +++ + +KE Q+ K ES C S K E EK E+ Sbjct: 105 DKGESEKDKGESEKDKGESEKDKGESEKEKCQSEKEKCESEKEKCESEKEKCESEKKVEE 164 Query: 194 ISDSD-KQTILDKCNDT 241 D + ++ I +K +DT Sbjct: 165 SKDENPEEKIEEKKDDT 181 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 31.5 bits (68), Expect = 0.49 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = +2 Query: 5 NKITITNDKGRLSKEEIERMVNEAE-KYRNEDDKQKETIQAKNALESYCFSMKSTMED 175 NKI + N+ + SKE++ER V AE + R+ D + K +++LE S +++D Sbjct: 1038 NKILVENENLKGSKEDLERRVVVAENRLRDTDSEMKGWRDIRSSLERDLQSRDHSIDD 1095 >SB_26151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 31.1 bits (67), Expect = 0.64 Identities = 13/58 (22%), Positives = 30/58 (51%) Frame = +2 Query: 2 ENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMED 175 EN++ K KEE+ + E+++ +K K+ ++ KN L+ +++ +E+ Sbjct: 180 ENEVASLKLKQETIKEEVVEEIEGDEEFQKLQNKYKQVVEEKNTLQGELDGLQTQLEE 237 >SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) Length = 256 Score = 31.1 bits (67), Expect = 0.64 Identities = 17/62 (27%), Positives = 32/62 (51%) Frame = +2 Query: 44 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 223 K E+E+ E EK R E +KQ+ + K LES ++ + + EK + ++ ++ Sbjct: 105 KNEVEKERQEEEKRRMEIEKQRMESEKKRILESKQKRIEESKDTIHDNEKFLEEQRKRLV 164 Query: 224 DK 229 +K Sbjct: 165 EK 166 >SB_57319| Best HMM Match : Pox_A_type_inc (HMM E-Value=6.3e-06) Length = 348 Score = 31.1 bits (67), Expect = 0.64 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +2 Query: 8 KITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKN-ALESYCFSMKSTMEDEK 181 ++T D G + EE++R+ NE EK +NE + K+ L++Y + E EK Sbjct: 126 QLTSKADYGNIHAEELQRIRNELEKCKNEISDLNSKLNTKSQKLKTYKKHIGELQEREK 184 >SB_15994| Best HMM Match : Pox_A_type_inc (HMM E-Value=2e-06) Length = 364 Score = 31.1 bits (67), Expect = 0.64 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +2 Query: 8 KITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKN-ALESYCFSMKSTMEDEK 181 ++T D G + EE++R+ NE EK +NE + K+ L++Y + E EK Sbjct: 126 QLTSKADYGNIHAEELQRIRNELEKCKNEISDLNSKLNTKSQKLKTYKKHIGELQEREK 184 >SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) Length = 317 Score = 31.1 bits (67), Expect = 0.64 Identities = 17/62 (27%), Positives = 32/62 (51%) Frame = +2 Query: 44 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 223 K E+E+ E EK R E +KQ+ + K LES ++ + + EK + ++ ++ Sbjct: 223 KNEVEKERQEEEKRRMEIEKQRMESEKKRILESKQKRIEESKDTIHDNEKFLEEQRKRLV 282 Query: 224 DK 229 +K Sbjct: 283 EK 284 >SB_45987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 30.7 bits (66), Expect = 0.85 Identities = 15/62 (24%), Positives = 34/62 (54%) Frame = +2 Query: 8 KITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLK 187 K+ I +D G L ++ N+ +K + E+D+ +E + E++ SM+ + D++ + Sbjct: 975 KVKIYDDDGDLKVSKLTGFFNDDDKEKEEEDRAEECEET----EAHIISMQEEVNDDETE 1030 Query: 188 EK 193 E+ Sbjct: 1031 EE 1032 >SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 30.7 bits (66), Expect = 0.85 Identities = 15/41 (36%), Positives = 26/41 (63%) Frame = +2 Query: 17 ITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALE 139 + +K RL EE+ER+ E +K E+ K++ET++ K L+ Sbjct: 277 LEEEKKRL--EELERLKEEKDKMLEEELKKRETLEEKQKLQ 315 >SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1967 Score = 30.3 bits (65), Expect = 1.1 Identities = 27/89 (30%), Positives = 46/89 (51%), Gaps = 8/89 (8%) Frame = +2 Query: 5 NKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKL 184 +K+ + + L ++ +VNE +K + + D QK+ I+ + ES + ME EKL Sbjct: 1171 SKVAHSEEILALKAARLKELVNELDKMKKDLDAQKQAIEESRSEES---GIIGEME-EKL 1226 Query: 185 KE---KISD-----SDKQTILDKCNDTIK 247 KE KIS +DK L+K + ++K Sbjct: 1227 KESKDKISKLEGTLNDKAKALEKAHLSLK 1255 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 30.3 bits (65), Expect = 1.1 Identities = 36/173 (20%), Positives = 69/173 (39%), Gaps = 12/173 (6%) Frame = +2 Query: 2 ENKITITNDKGRLSKEEIERMVNEAEKYRNED----DKQKETIQAKNALESYCFSMKSTM 169 E K+ I +K K++ ER+ + EK + ++ K+KE + ++ L + Sbjct: 939 EKKLLIEKEKREKEKQK-ERLREKEEKEKQKEAERAKKEKERLLQEDKLHEKEEKDRKDK 997 Query: 170 EDEKLKEKISDSDKQTILDKCNDTIKWLVPTNWPTRRSMSTSRKNWKAFAIR**RRCTRV 349 E K++++ + DKQ +K + + + R + + K + + T V Sbjct: 998 EKRKVEKEKREKDKQVEKEKKDSLKRVKKRKDSDKERKVKEKEEEQKVKIEKEPNKVTEV 1057 Query: 350 --------PEESPEVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPTFHTTRK 484 EESP R + +E P+ L A + +KP +RK Sbjct: 1058 QLMVEETNKEESPSTDRDAESELPKAGSVSALLSVFATEPSKPLKPAIRYSRK 1110 Score = 28.7 bits (61), Expect = 3.4 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 15 PLPTTKVVSPRKRSSVWLMRQRSTETRMTSKRR 113 PLP T V R R WL + E+ TSK+R Sbjct: 297 PLPET-VAEERSRKGSWLRSLKKNESEKTSKKR 328 >SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) Length = 649 Score = 30.3 bits (65), Expect = 1.1 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Frame = +2 Query: 44 KEEIERMVNEAEKYRNEDDK-QKETIQAKNALESYCFSMKSTMED-EKLKEKISDSDKQ 214 KE+I+ NEA++ + DK +KE +KN LES +K+ ++ +E I+ ++Q Sbjct: 2 KEDIQVRSNEAQREARKKDKLEKELKTSKNDLESKTAELKTKQSQLQRNQEDIAKLEQQ 60 >SB_40528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 30.3 bits (65), Expect = 1.1 Identities = 21/76 (27%), Positives = 37/76 (48%), Gaps = 6/76 (7%) Frame = +1 Query: 136 GILLLQHEVYHGG*EAQGKDL*L*QADHPRQV-----QRHHQVAGSNQLADKEEYEHKQK 300 G+L L + HG A G+D L + D R++ Q+H ++ + AD++E +H Sbjct: 57 GLLELMDDFNHGRLHAFGRDFTLEKMDKVRELQERVAQQHFELDNAETEADEDEVKHNGF 116 Query: 301 ELEGICN-PIITKMYQ 345 + N P+ T+ Q Sbjct: 117 SSDNAANHPVATETRQ 132 >SB_12462| Best HMM Match : Kinesin (HMM E-Value=0) Length = 803 Score = 30.3 bits (65), Expect = 1.1 Identities = 18/70 (25%), Positives = 34/70 (48%) Frame = +2 Query: 26 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 205 D+ + + I+R+ N + Y+ E D +E + E Y S++ + KL+++I D Sbjct: 560 DEIKFKTKTIDRLENRLQSYQVEIDDLQEEFERDR--EDYLDSIRKQEQTIKLQQQIIDK 617 Query: 206 DKQTILDKCN 235 + I CN Sbjct: 618 IQPCIRRDCN 627 >SB_42014| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.083) Length = 1007 Score = 29.9 bits (64), Expect = 1.5 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = +2 Query: 44 KEEIERMVNEAEKYRNEDDKQKETIQAKNA-LESYCFSMKSTMEDEKLKEKISDSDKQTI 220 + E+E+ E EK DK+K+ ++ N L S+ S + DE KE +D+ Q I Sbjct: 837 RSELEKAKGEIEKAWTLYDKEKDRLEKLNGQLIDELKSLTSVL-DEMKKESENDAQCQKI 895 Query: 221 LD 226 LD Sbjct: 896 LD 897 >SB_23940| Best HMM Match : MuDR (HMM E-Value=0.24) Length = 685 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/62 (24%), Positives = 33/62 (53%) Frame = +2 Query: 8 KITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLK 187 K+ I +D G L ++ N+ +K E+D+ +E + E++ SM+ + D++ + Sbjct: 448 KVKIYDDDGDLKVSKLTGFFNDDDKEEEEEDRAEECEET----EAHIISMQEEVNDDETE 503 Query: 188 EK 193 E+ Sbjct: 504 EE 505 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 29.9 bits (64), Expect = 1.5 Identities = 18/62 (29%), Positives = 35/62 (56%) Frame = +2 Query: 26 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 205 ++ + KEE ER+ EAE+ R ED++Q+ + + A E +K M+ K + + ++ Sbjct: 411 EEEKRQKEEEERLRVEAERQREEDERQRAEDERQRA-EDERQRVKHEMQRLKDERRRAEE 469 Query: 206 DK 211 D+ Sbjct: 470 DE 471 >SB_52390| Best HMM Match : Cauli_DNA-bind (HMM E-Value=6.4) Length = 232 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/62 (24%), Positives = 33/62 (53%) Frame = +2 Query: 8 KITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLK 187 K+ I +D G L ++ N+ +K E+D+ +E + E++ SM+ + D++ + Sbjct: 87 KVKIYDDDGDLKVSKLTGFFNDDDKEEEEEDRAEECEET----EAHIISMQEEVNDDETE 142 Query: 188 EK 193 E+ Sbjct: 143 EE 144 >SB_40368| Best HMM Match : SASP_gamma (HMM E-Value=2.3) Length = 325 Score = 29.9 bits (64), Expect = 1.5 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 5/53 (9%) Frame = +2 Query: 350 PEESPEVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPTFHT-----TRKPTC 493 P + P R SR E P PE PP L+ LA P+ + +P+ T R PTC Sbjct: 19 PAKKPPPRRRSR-ETP-PETPPVQLKHLAGPAEKPHRPSRETPPVQPRRNPTC 69 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 29.5 bits (63), Expect = 2.0 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = +2 Query: 26 DKGRLSKEEIERMVNEAEKYRNEDDKQK--ETIQAKNALESYCFSMKSTMEDEKLKEK 193 +K RL K++ E +K + E++K+K E I AK + K E+EK+K+K Sbjct: 365 EKERLEKKQREEKDRLEKKEKKEEEKRKKEEEINAKIEEKKKREEKKKQEEEEKMKKK 422 Score = 28.7 bits (61), Expect = 3.4 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = +2 Query: 44 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEK 193 K+E ER+ +AEK + K+KE ++ K E K E+EK K++ Sbjct: 349 KKEQERLEKQAEK----EKKEKERLEKKQREEKDRLEKKEKKEEEKRKKE 394 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 29.5 bits (63), Expect = 2.0 Identities = 20/60 (33%), Positives = 30/60 (50%) Frame = +2 Query: 26 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 205 DK +L KEE E+ + E NE KQKE +A++ L++ + D K E D+ Sbjct: 1606 DKYQLEKEEAEKRLQSYEDELNEKQKQKE--KAEDNLKALKKRISDLEVDNKNLETARDN 1663 >SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 23.8 bits (49), Expect(2) = 2.5 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +2 Query: 344 RVPEESPEVCRASRAEHPEPEVPPPGLEALAPPS 445 R PE+ EV S + P L+ L PPS Sbjct: 28 RFPEDDLEVSSVSASASSSTSRPTNALQPLKPPS 61 Score = 23.8 bits (49), Expect(2) = 2.5 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 431 LAPPSRRSIKPTFHTTRKPTCNNH 502 L PPSR+S P HT P+C ++ Sbjct: 80 LTPPSRQSNNPRPHT--PPSCQSN 101 >SB_3809| Best HMM Match : DUF1014 (HMM E-Value=8.7e-09) Length = 265 Score = 29.1 bits (62), Expect = 2.6 Identities = 16/60 (26%), Positives = 32/60 (53%) Frame = +2 Query: 26 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 205 +K R +EE +++ + +K+ ++ K+ E ++ KNA E++ LK K S+S Sbjct: 50 EKERKEREEEDKLWEDDDKHEQQEKKRLEALERKNAARQML-----EEEEKSLKGKTSNS 104 >SB_1024| Best HMM Match : Ank (HMM E-Value=0) Length = 891 Score = 29.1 bits (62), Expect = 2.6 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +2 Query: 350 PEESP--EVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPT 466 PE+ P EV A R E P+ E PP +PP ++ KPT Sbjct: 771 PEQPPIGEVESAVRREQPKSEKTPPSTTP-SPPPKQPSKPT 810 >SB_59386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1037 Score = 29.1 bits (62), Expect = 2.6 Identities = 15/41 (36%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = +2 Query: 20 TNDKGRLSKEEIERMVNEAEKY-RNEDDKQKETIQAKNALE 139 TND G S +E E VN ++K NE++ + E ++ +N++E Sbjct: 888 TNDNGS-STDEAESEVNNSDKEGENEENDEVEDMEVENSIE 927 >SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 28.7 bits (61), Expect = 3.4 Identities = 24/82 (29%), Positives = 33/82 (40%), Gaps = 10/82 (12%) Frame = -2 Query: 517 KERYKVVVTGRFTCGVECWFNRPPRWWGQRLQPRGRH---------LRLRVLRPGSPAYL 365 K +V+ G F CG W + PP P + L VL P PA L Sbjct: 73 KSHPNIVIAGDFNCGDINWNSDPPSITNHASAPMMNYLLDFISNNALTQHVLHPTRPASL 132 Query: 364 RGL-LRHPGTSSLLSDCKCLPI 302 L L + +L+SD + LP+ Sbjct: 133 NTLDLVLSSSPALVSDVRILPV 154 >SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.7 bits (61), Expect = 3.4 Identities = 18/66 (27%), Positives = 34/66 (51%) Frame = +2 Query: 2 ENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 181 +NK T + + K+E R+ +EAEK E++K K+ + + + Y ++ + K Sbjct: 454 QNKDAATRYRVK-KKDEQSRLFDEAEKLEKENNKLKDEVGSLSKEIEYLKNLMLEVYQTK 512 Query: 182 LKEKIS 199 K+K S Sbjct: 513 QKQKES 518 >SB_33252| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 28.7 bits (61), Expect = 3.4 Identities = 24/108 (22%), Positives = 50/108 (46%) Frame = +2 Query: 134 LESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLVPTNWPTRRSMSTSRKNWKA 313 LE+ + + E+ +E + ++Q++ + + ++P P R SMS + + + Sbjct: 64 LENQRLENQRLLRREEEEENTKEEERQSVEEPLGTPLA-MIP---PKRPSMSATLRPSQT 119 Query: 314 FAIR**RRCTRVPEESPEVCRASRAEHPEPEVPPPGLEALAPPSRRSI 457 R + T+ ++ A+ A P P PP G+ A A S+R++ Sbjct: 120 AIARRGKTLTKKKKKKT----ATAAGFPPPTQPPRGMTATARKSKRNV 163 >SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1128 Score = 28.7 bits (61), Expect = 3.4 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +2 Query: 371 CRASRAEHPEPEVPPPGLEALAPPSRRSIKPTFHTTRKPT 490 C A A+ P+ +VPPP APP + P TT PT Sbjct: 92 CNAKPAQ-PDTDVPPPPATTSAPPPPTTTAPP-ATTSPPT 129 >SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 28.7 bits (61), Expect = 3.4 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 2/67 (2%) Frame = +2 Query: 35 RLSKEEIERMVNEAEKYRNED--DKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSD 208 + K+E ER E EK R ++ ++KE + + E K E ++ KEK+ + + Sbjct: 316 KAKKKEKERQEREKEKEREKERIQQEKEKQKERREKEKQKHQEKKEKERQREKEKL-EKE 374 Query: 209 KQTILDK 229 KQ L++ Sbjct: 375 KQKELER 381 >SB_6748| Best HMM Match : Pkinase (HMM E-Value=1.7e-05) Length = 315 Score = 28.7 bits (61), Expect = 3.4 Identities = 15/57 (26%), Positives = 31/57 (54%) Frame = +2 Query: 29 KGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS 199 K ++ K+++++ E ++ DDK KET+ N +ES + E++ E++S Sbjct: 229 KKQIEKQKLQQDEIEQGLLQDSDDKDKETL-GDNCIESNDMEESAKDSSEEISEELS 284 >SB_54892| Best HMM Match : DHH (HMM E-Value=0.057) Length = 384 Score = 28.3 bits (60), Expect = 4.5 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 2/76 (2%) Frame = +2 Query: 26 DKGRLSKEEIERMVNEAEKYRNED-DKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD 202 DK + + EE+ VNEA K E KQ++T Q+ + + C ++ E+ S+ Sbjct: 156 DKVKFNLEELYHSVNEATKRNTEAIQKQRQTRQSPASPGTICRLYNKKLDFEQFDYGFSE 215 Query: 203 SDKQTI-LDKCNDTIK 247 + K + +D TIK Sbjct: 216 TIKGLLCVDVSAVTIK 231 >SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) Length = 440 Score = 28.3 bits (60), Expect = 4.5 Identities = 17/39 (43%), Positives = 19/39 (48%) Frame = +3 Query: 3 RTRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTSKRRPS 119 R RS P + SPRKRS R RS R S R+ S Sbjct: 198 RKRSRSPRKMLRSPRKRSRTPRKRSRSPRKRSRSPRKGS 236 >SB_32331| Best HMM Match : DivIVA (HMM E-Value=0.86) Length = 888 Score = 28.3 bits (60), Expect = 4.5 Identities = 14/62 (22%), Positives = 33/62 (53%) Frame = +2 Query: 8 KITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLK 187 ++ I +D G L ++ N+ +K E+D+ +E + E++ SM+ + D++ + Sbjct: 618 EVKIYDDDGDLKVSKLTGFFNDDDKEEEEEDRAEECEET----EAHIISMQEEVNDDETE 673 Query: 188 EK 193 E+ Sbjct: 674 EE 675 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 28.3 bits (60), Expect = 4.5 Identities = 19/71 (26%), Positives = 32/71 (45%) Frame = +2 Query: 2 ENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 181 E K ++ +EE ER E K E+ KQ+E + K E + E+E+ Sbjct: 434 ERKKREAEEEEERRREEEERREEEERKREEEERKQREEEEKKREEEE-----RKQREEEE 488 Query: 182 LKEKISDSDKQ 214 K+K + +K+ Sbjct: 489 RKQKEKEEEKK 499 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 28.3 bits (60), Expect = 4.5 Identities = 24/98 (24%), Positives = 45/98 (45%), Gaps = 3/98 (3%) Frame = +2 Query: 17 ITNDKGRLSKEEIER--MVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKE 190 ITN G++ KEE +R V E++K K++E I+ K A + E++++KE Sbjct: 1145 ITNAMGKIEKEEAKRKAAVEESQKAIEAARKKQEEIRQKQAA-----WRQQEEEEQRVKE 1199 Query: 191 KISD-SDKQTILDKCNDTIKWLVPTNWPTRRSMSTSRK 301 ++ +++ ++ N L+ R RK Sbjct: 1200 RLQILREERERIEALNKEADLLIQRRKEAERKAEEKRK 1237 >SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) Length = 805 Score = 28.3 bits (60), Expect = 4.5 Identities = 17/55 (30%), Positives = 31/55 (56%) Frame = +2 Query: 47 EEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDK 211 EE+E + + E+ R+ + Q ET++ +N E K T E++ LKE I+ ++ Sbjct: 54 EELEDRIAKLEEERDNLEVQLETVRKENDTE----MEKQTNENDTLKETITGHEE 104 >SB_47601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 652 Score = 27.9 bits (59), Expect = 6.0 Identities = 17/45 (37%), Positives = 20/45 (44%) Frame = +2 Query: 350 PEESPEVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPTFHTTRK 484 P +P RA+ P+P V P A APP R P HT K Sbjct: 220 PRPAPARDRAASGPGPKPAVKPRDRLATAPPGR---PPAPHTREK 261 >SB_40334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1061 Score = 27.9 bits (59), Expect = 6.0 Identities = 16/62 (25%), Positives = 30/62 (48%) Frame = +2 Query: 23 NDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD 202 +D ++ EE E ++AE E D++ +A ++ S +D++L EK+ D Sbjct: 975 SDASHVTSEE-EMQASDAESEEKEKDEESSDAEAPSSSRKRVISSD---DDDELDEKLDD 1030 Query: 203 SD 208 D Sbjct: 1031 DD 1032 >SB_32124| Best HMM Match : K-box (HMM E-Value=4.1) Length = 207 Score = 27.9 bits (59), Expect = 6.0 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 3/68 (4%) Frame = +2 Query: 44 KEEIERMVNEAEKYRNE-DDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS--DSDKQ 214 K +IE + E + E DD Q+ET K L SY MKS +K ++ +S+ + Sbjct: 137 KIKIEELEVRIEDLKEENDDYQQETKYLKQVL-SYREDMKSVQVSQKATRQLQKLESNLE 195 Query: 215 TILDKCND 238 KC D Sbjct: 196 DAEKKCKD 203 >SB_31911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1312 Score = 27.9 bits (59), Expect = 6.0 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +1 Query: 208 QADHPRQVQRHHQVAGSNQLADKEEYEHKQKELEGICNPIITK 336 Q + +Q+Q + A L KE+YE K +L+ N + K Sbjct: 869 QEEIMKQIQLEKEAAQERLLKQKEQYEQKTLQLQSALNDLNVK 911 >SB_3206| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00047) Length = 256 Score = 27.9 bits (59), Expect = 6.0 Identities = 25/84 (29%), Positives = 34/84 (40%), Gaps = 10/84 (11%) Frame = -2 Query: 517 KERYKVVVTGRFTCGVECWFNRPPRWWGQRLQPRGRH---------LRLRVLRPGSPAYL 365 K +V+ G F CG W + PP P + L VL P PA L Sbjct: 130 KSHPNIVIAGDFNCGDINWNSDPPSITNHASAPMMNYLLDFISNNALTQHVLHPTRPASL 189 Query: 364 RGL-LRHPGTSSLLSDCKCLPILS 296 L L + +L+SD + LP +S Sbjct: 190 NTLDLVLSSSLALVSDVRILPGMS 213 >SB_3000| Best HMM Match : Extensin_2 (HMM E-Value=0.058) Length = 1002 Score = 27.9 bits (59), Expect = 6.0 Identities = 21/74 (28%), Positives = 34/74 (45%) Frame = +2 Query: 14 TITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEK 193 T N+K +L ++E+ER + E ++E + A + S E KLKE+ Sbjct: 677 TERNEKAKLHRQELERKMQEEAMKKHETELD---YLAPFLAQIGDPPRISRQEAYKLKEE 733 Query: 194 ISDSDKQTILDKCN 235 KQ ++DK N Sbjct: 734 CLQDLKQRLIDKAN 747 >SB_2140| Best HMM Match : DUF1154 (HMM E-Value=1) Length = 155 Score = 27.9 bits (59), Expect = 6.0 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 1/71 (1%) Frame = +2 Query: 2 ENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 181 E+K++ G+ KE I E + E +Q ETI ++ E T E+ Sbjct: 78 EHKMSTEEALGQQRKELIHEKNKELDGLNKEHQRQIETIVEQHGKEIDVM----TKENAS 133 Query: 182 LKEKI-SDSDK 211 LKEK+ S SDK Sbjct: 134 LKEKLKSTSDK 144 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 27.9 bits (59), Expect = 6.0 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 395 PEPEVPPPGLEALAPPSRRSIKP 463 P+P+ PPPG PPS + P Sbjct: 28 PKPDTPPPGTNIPTPPSPNTPPP 50 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 27.9 bits (59), Expect = 6.0 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +2 Query: 395 PEPEVPPPGLE-ALAPPSRRSIKPTFH 472 P P PPP L A APP R P H Sbjct: 425 PPPPPPPPALRLACAPPRLRFTSPVLH 451 >SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) Length = 1998 Score = 27.9 bits (59), Expect = 6.0 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = +2 Query: 47 EEIERMVNE-AEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD 202 E+ E+++ + AEK R +K+KE + E F + + +DE L +K+ D Sbjct: 1446 EKREKVLQDGAEKDRKGFEKEKEEFEEAFRKEKKIFQDELSKKDEDLAQKLQD 1498 >SB_11244| Best HMM Match : M (HMM E-Value=2.5e-08) Length = 1381 Score = 27.9 bits (59), Expect = 6.0 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 3/68 (4%) Frame = +2 Query: 44 KEEIERMVNEAEKYRNE-DDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS--DSDKQ 214 K +IE + E + E DD Q+ET K L SY MKS +K ++ +S+ + Sbjct: 874 KIKIEELEVRIEDLKEENDDYQQETKYLKQVL-SYREDMKSVQVSQKATRQLQKLESNLE 932 Query: 215 TILDKCND 238 KC D Sbjct: 933 DAEKKCKD 940 >SB_33413| Best HMM Match : DUF81 (HMM E-Value=0.31) Length = 455 Score = 27.5 bits (58), Expect = 7.9 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +2 Query: 173 DEKLKEKISDSDKQTILDKCND 238 D +++ ++ D D+QT+ D C+D Sbjct: 378 DVEVRRRVQDIDRQTVTDDCDD 399 >SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 27.5 bits (58), Expect = 7.9 Identities = 12/62 (19%), Positives = 34/62 (54%) Frame = +2 Query: 44 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 223 K+E++ + E+ + ++QK+ +Q + E K +++E+ K+++ + KQ + Sbjct: 88 KQEVQEEQKQEEQEEQKQEEQKQEVQEEQKQEEQ-EEQKQEVQEEQ-KQEVQEEQKQEVQ 145 Query: 224 DK 229 ++ Sbjct: 146 EE 147 >SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1480 Score = 27.5 bits (58), Expect = 7.9 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = -2 Query: 409 HLRLRVLRPGSPAYLRGLLRHPGTSSLLSDCKCLPILSACAH 284 HL +RVL P P L LS C CLP+ +C H Sbjct: 1140 HLSVRVLSPVCPRVFTCLYACVN----LSVCVCLPVCFSCVH 1177 Score = 27.5 bits (58), Expect = 7.9 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = -2 Query: 409 HLRLRVLRPGSPAYLRGLLRHPGTSSLLSDCKCLPILSACAH 284 HL +RVL P P L LS C CLP+ +C H Sbjct: 1177 HLSVRVLSPVCPRVFTCLYACVN----LSVCVCLPVCFSCVH 1214 >SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3934 Score = 27.5 bits (58), Expect = 7.9 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +2 Query: 74 AEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD-SDKQ 214 AEKY +E ++K+ ++ LES + + E L++K+S+ S+K+ Sbjct: 2091 AEKYEHESQEKKKIVEISETLESKNRKQQELL--ESLEKKLSEFSEKE 2136 >SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) Length = 418 Score = 27.5 bits (58), Expect = 7.9 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +2 Query: 47 EEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 181 E E + N+ ++ +DDK++ET K + + S EDEK Sbjct: 40 EAAEEVENKMDEMSVKDDKREETQSDKKSAKESTKSSSKPAEDEK 84 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 27.5 bits (58), Expect = 7.9 Identities = 20/64 (31%), Positives = 37/64 (57%) Frame = +2 Query: 14 TITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEK 193 T+ ND ++K+E+ER+ +K D+K+KE ++ K L+ TME ++L+ Sbjct: 3498 TVDND---ITKDELERL----KKIVENDEKEKENLKRK--LQG--SDSDGTMERKRLQRD 3546 Query: 194 ISDS 205 +SD+ Sbjct: 3547 MSDA 3550 >SB_18255| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1457 Score = 27.5 bits (58), Expect = 7.9 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 44 KEEIERMVNEAEKYRNEDDKQKETIQ-AKNALESYCFSMKSTMEDEKLKEKISDSDK 211 KE E +NE +KY N+ K +Q KNAL+ + S D L K + ++ Sbjct: 811 KERSEAWLNEKQKYTNDIKHIKTEVQLCKNALDGTKQKVLSLENDLLLTSKQLEKER 867 >SB_8591| Best HMM Match : DUF601 (HMM E-Value=0.23) Length = 3368 Score = 27.5 bits (58), Expect = 7.9 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +2 Query: 437 PPSRRSIKPTFHTTRKPTCNNHLVPLLD*NK*ISNL 544 P + + KPT + KPT NN V L + NK S L Sbjct: 3138 PTTNNNSKPTTNNNSKPTTNNKKVNLNNTNKKDSEL 3173 >SB_3240| Best HMM Match : Sec8_exocyst (HMM E-Value=0.48) Length = 643 Score = 27.5 bits (58), Expect = 7.9 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = +2 Query: 35 RLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKE 190 R S EE+ R E E E K +ETIQ N E MK + D+ ++ Sbjct: 380 RASVEELVRTRKELEMKEKELQKAQETIQQMNEREQ---QMKERLADQAQRQ 428 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,312,142 Number of Sequences: 59808 Number of extensions: 370688 Number of successful extensions: 2125 Number of sequences better than 10.0: 65 Number of HSP's better than 10.0 without gapping: 1775 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2104 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1312894764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -