BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00466 (659 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo... 29 0.45 SPCC417.08 |tef3||translation elongation factor eEF3|Schizosacch... 27 1.8 SPCC965.06 |||potassium channel subunit |Schizosaccharomyces pom... 26 4.2 SPCC594.04c |||steroid oxidoreductase superfamily protein|Schizo... 26 5.5 SPBC15D4.13c |||sequence orphan|Schizosaccharomyces pombe|chr 2|... 26 5.5 SPAC20H4.01 ||SPAC631.03|U3 snoRNP-associated protein Utp5|Schiz... 25 9.7 >SPCC18.03 |||shuttle craft like transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 1077 Score = 29.5 bits (63), Expect = 0.45 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +3 Query: 255 SNGPDMGRKIPNRIPVRDENDCDTRAYIKDDSVKIVTLMSAPI-IPNSA 398 S P G ++PN +N+ + + +K+DS K SAPI +P S+ Sbjct: 31 SISPSSGSELPNFKTTISQNNEEVKTSLKEDSSKFHPSASAPIFVPTSS 79 >SPCC417.08 |tef3||translation elongation factor eEF3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1047 Score = 27.5 bits (58), Expect = 1.8 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = +3 Query: 282 IPNRIPVRDENDCDTRAYIKDDSVKIVTLMSAPIIPNSARDITRIVNERVGMV 440 +P IPV E+ DT+A +K S + +T + +I N+ DI R + E + + Sbjct: 173 LPQIIPVVSESMWDTKAEVKKQSKETMTKV-CTLIANA--DIDRFIPELINCI 222 >SPCC965.06 |||potassium channel subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 344 Score = 26.2 bits (55), Expect = 4.2 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 541 LLTGTYNDGLARGFPQQATSYGSAFQVRLDRGLRQ 645 +LTG YNDG+ G T A Q++ G Q Sbjct: 229 ILTGKYNDGIPEGSRLSTTFTSLAGQLQTPEGKTQ 263 >SPCC594.04c |||steroid oxidoreductase superfamily protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 338 Score = 25.8 bits (54), Expect = 5.5 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +1 Query: 82 KYPYSDLPYIGQYKLLKLPFTGKLIEHVDYWGEGSIVNGGLYS 210 K+ + PY+ Q LKL FTGKL Y+ V G L S Sbjct: 12 KWKVAVSPYLYQLSNLKLLFTGKLNFADFYYNTNPFVVGLLLS 54 >SPBC15D4.13c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 212 Score = 25.8 bits (54), Expect = 5.5 Identities = 13/49 (26%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Frame = +3 Query: 219 QLLQREPTVPRGSNGPDMGRKIPNRIPVRDEND---CDTRAYIKDDSVK 356 +L +P + G GP + IPV+++ D C Y K+D ++ Sbjct: 26 KLTSNDPMILSGFRGPRVSHLTIGMIPVKNDEDVLKCMDFLYNKEDEIR 74 >SPAC20H4.01 ||SPAC631.03|U3 snoRNP-associated protein Utp5|Schizosaccharomyces pombe|chr 1|||Manual Length = 666 Score = 25.0 bits (52), Expect = 9.7 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 356 FDRVILDVSPGVAVVFVAHRDPVGDLATHVGPV 258 F + L S + +V + HR+P+ L TH + Sbjct: 174 FKNLALASSHNIHIVDLNHRNPIDSLTTHTSMI 206 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,695,536 Number of Sequences: 5004 Number of extensions: 55698 Number of successful extensions: 165 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 159 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 165 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 299817502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -