BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00466 (659 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 27 0.69 DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. 25 1.6 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 24 3.7 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 26.6 bits (56), Expect = 0.69 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = +2 Query: 251 R*QRARHGSQDPQQDPGARRKRLRHPGLHQG*LGQNSDAHERAHHSEQRQR 403 R Q+ Q PQQ ++R + HQG ++AH +QRQ+ Sbjct: 255 RSQQQPQQQQQPQQKQQQLQRRQQQQQQHQGQRYVPPQLRQQAHQQQQRQQ 305 >DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. Length = 409 Score = 25.4 bits (53), Expect = 1.6 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = -1 Query: 470 LRLYRHAVYDDHADAFVNDSRNVSGAVRNDGRAHERHYFDRVI 342 L L A +A N R +S ++ND H R Y+ +++ Sbjct: 64 LTLIYEASDTSFGNAVSNTKRELSSVIQNDNIDHTRSYYKQLL 106 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.2 bits (50), Expect = 3.7 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -1 Query: 296 DPVGDLATHVGPVATSW 246 DP THV P T+W Sbjct: 224 DPTATTTTHVPPTTTTW 240 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 706,427 Number of Sequences: 2352 Number of extensions: 15966 Number of successful extensions: 212 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 212 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 212 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65650335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -