BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00465 (761 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein pro... 23 4.1 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 22 5.4 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 7.1 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 21 9.4 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 21 9.4 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 21 9.4 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 21 9.4 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 21 9.4 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 21 9.4 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 21 9.4 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 9.4 >L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein protein. Length = 74 Score = 22.6 bits (46), Expect = 4.1 Identities = 14/43 (32%), Positives = 17/43 (39%) Frame = -2 Query: 478 FTRRDHTHILYTLVRFEVTYLCSYLYFSFIGYGNLIARQRIKT 350 FTR H L E Y CS+ F+ NL R+ T Sbjct: 19 FTRDHHLKTHMRLHTGEKPYHCSHCDRQFVQVANLRRHLRVHT 61 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +2 Query: 203 TEGRILRYRNEVXALWSPLINGALGDGRLR 292 TE L + V W L+N +G+G R Sbjct: 603 TEEDALNLSSAVWFAWGVLLNSGIGEGTPR 632 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.8 bits (44), Expect = 7.1 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = -1 Query: 716 LVASTPFIISILASS*YFCDLACSFSISVTVPILD 612 ++ T ++ +L F + +FSI VTV +L+ Sbjct: 292 IIPPTSLVVPLLGKFVLFTMILDTFSICVTVVVLN 326 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 94 SIRDMVPRFSLQLPPWP 44 SI++ VPRF PP P Sbjct: 140 SIQEQVPRFRYIGPPTP 156 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 94 SIRDMVPRFSLQLPPWP 44 SI++ VPRF PP P Sbjct: 140 SIQEQVPRFRYIGPPTP 156 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 94 SIRDMVPRFSLQLPPWP 44 SI++ VPRF PP P Sbjct: 140 SIQEQVPRFRYIGPPTP 156 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 94 SIRDMVPRFSLQLPPWP 44 SI++ VPRF PP P Sbjct: 140 SIQEQVPRFRYIGPPTP 156 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 94 SIRDMVPRFSLQLPPWP 44 SI++ VPRF PP P Sbjct: 140 SIQEQVPRFRYIGPPTP 156 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 94 SIRDMVPRFSLQLPPWP 44 SI++ VPRF PP P Sbjct: 144 SIQEQVPRFRYIGPPTP 160 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 94 SIRDMVPRFSLQLPPWP 44 SI++ VPRF PP P Sbjct: 140 SIQEQVPRFRYIGPPTP 156 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 94 SIRDMVPRFSLQLPPWP 44 SI++ VPRF PP P Sbjct: 365 SIQEQVPRFRYIGPPTP 381 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,480 Number of Sequences: 438 Number of extensions: 4732 Number of successful extensions: 28 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -