BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00464X (583 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q23BR5 Cluster: Protein kinase domain containing protei... 33 3.7 >UniRef50_Q23BR5 Cluster: Protein kinase domain containing protein; n=1; Tetrahymena thermophila SB210|Rep: Protein kinase domain containing protein - Tetrahymena thermophila SB210 Length = 1233 Score = 33.5 bits (73), Expect = 3.7 Identities = 21/85 (24%), Positives = 45/85 (52%) Frame = -3 Query: 317 VFDRSSPFSAFWNIDSQIGIRKCYKPTVEKLIQNVLKLTLNS*GYECIKINEAFFENVKY 138 V+ F + +++ + + +EK+I + L S Y+C+K+++ FF+++K Sbjct: 757 VYSLGKTFREVLRVYNKLNNKTQFIMQIEKIINENMVLENASDRYDCLKLHQLFFDSIK- 815 Query: 137 YLEKIVSHVQFCLQVFYQLKKHRFI 63 YL+ + +F L+ FYQ K + + Sbjct: 816 YLDDNAN--KFFLE-FYQKKIFKLV 837 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 506,687,503 Number of Sequences: 1657284 Number of extensions: 9639170 Number of successful extensions: 19251 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 18791 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19249 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 40404161459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -