BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00464X (583 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 27 0.10 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 27 0.10 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 23 2.9 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 27.5 bits (58), Expect = 0.10 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = -3 Query: 239 TVEKLIQNVLKLTLNS*GYECIKINEAFFENVKYYLEKIVSHVQFCLQV 93 T+EK + N+ Y C+K++ F YYL +I ++ C+ V Sbjct: 210 TLEKFFTDYCNSKTNTGEYSCLKVDLLFKREFSYYLIQI--YIPCCMLV 256 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 27.5 bits (58), Expect = 0.10 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = -3 Query: 239 TVEKLIQNVLKLTLNS*GYECIKINEAFFENVKYYLEKIVSHVQFCLQV 93 T+EK + N+ Y C+K++ F YYL +I ++ C+ V Sbjct: 210 TLEKFFTDYCNSKTNTGEYSCLKVDLLFKREFSYYLIQI--YIPCCMLV 256 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 22.6 bits (46), Expect = 2.9 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +2 Query: 128 FLDNTLHFQKMPRLS*YIHTLNCLMSILKHF 220 F D +H + + Y H + + +LKHF Sbjct: 135 FSDKNIHVSFLRTVPPYSHQTDVWVELLKHF 165 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,786 Number of Sequences: 438 Number of extensions: 2988 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16870914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -