BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00462 (616 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11396| Best HMM Match : Ribosomal_S2 (HMM E-Value=0) 160 7e-40 SB_99| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_16496| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_3365| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_54185| Best HMM Match : Gal_Lectin (HMM E-Value=2.3) 29 4.0 SB_43606| Best HMM Match : Y_phosphatase (HMM E-Value=3.9e-26) 29 4.0 SB_57493| Best HMM Match : Surf_Ag_VNR (HMM E-Value=0.00037) 28 5.2 SB_1986| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_53468| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) 27 9.1 SB_49920| Best HMM Match : MANEC (HMM E-Value=0.73) 27 9.1 SB_44668| Best HMM Match : 7tm_1 (HMM E-Value=6.1e-05) 27 9.1 >SB_11396| Best HMM Match : Ribosomal_S2 (HMM E-Value=0) Length = 328 Score = 160 bits (389), Expect = 7e-40 Identities = 73/85 (85%), Positives = 79/85 (92%) Frame = +1 Query: 253 PADVFVISSRPFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQD 432 PADV VIS+RP+GQRA+LK+A+HTGATPIAGRFTPG FTNQIQAAFREPRLLIV DP D Sbjct: 71 PADVCVISARPYGQRAILKYASHTGATPIAGRFTPGTFTNQIQAAFREPRLLIVCDPRID 130 Query: 433 HQPITEASYVNIPVIALCNTDSPLR 507 HQP+TEASYVNIPVIA CNTDSPLR Sbjct: 131 HQPVTEASYVNIPVIAFCNTDSPLR 155 Score = 109 bits (262), Expect = 2e-24 Identities = 48/71 (67%), Positives = 59/71 (83%) Frame = +2 Query: 44 MSGGLDVLALNEEDVTKMLAATTHLGAENVNFQMETYVYKRRADGTHVINLRRTWEKLVL 223 MSGGLD+L L EEDV K LAA HLGA N +FQME YVYKR++DG ++IN+++TWEKL+L Sbjct: 1 MSGGLDILQLKEEDVVKFLAAGVHLGANNCDFQMEDYVYKRKSDGVNIINVKKTWEKLLL 60 Query: 224 AARAVVAIENP 256 AAR +V IENP Sbjct: 61 AARIIVTIENP 71 Score = 62.5 bits (145), Expect = 3e-10 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +3 Query: 498 PTKIVDIAIPCNTKSSHSIGLMLWLLAREVLRLRGVLPR 614 P + VD+AIPCN K HSIGLM WLLAREVLR+RG + R Sbjct: 153 PLRHVDVAIPCNNKGIHSIGLMFWLLAREVLRMRGSISR 191 >SB_99| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 30.7 bits (66), Expect = 0.98 Identities = 19/55 (34%), Positives = 27/55 (49%) Frame = -2 Query: 489 VAQSNHRNVDI*SFSNGLMVLCRVQYNQETRFTECSLNLVSKSTWCETPRNRRST 325 V SN +V + N + CR Q NQ T FT + ++ C+T RN RS+ Sbjct: 876 VYNSNKGSVRVHPSDNSGSLNCRKQTNQTTAFTWPGVVNLTWKRGCQTMRNMRSS 930 >SB_16496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1275 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 209 EKLVLAARAVVAIENPLMCSSSHHGPSVSVL 301 +K+ LA RA VAI+ L C + +HG V+ Sbjct: 482 DKVYLATRATVAIKIVLQCDTRYHGQQNKVI 512 >SB_3365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 335 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 209 EKLVLAARAVVAIENPLMCSSSHHGPSVSVL 301 +K+ LA RA VAI+ L C + +HG V+ Sbjct: 267 DKVYLATRATVAIKIVLQCDTRYHGQQNKVI 297 >SB_54185| Best HMM Match : Gal_Lectin (HMM E-Value=2.3) Length = 225 Score = 28.7 bits (61), Expect = 4.0 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = -2 Query: 489 VAQSNHRNVDI*SFSNGLMVLCRVQYNQETRFTECSLNLVSKSTWCETPRNRR 331 V SN +V + N + CR Q NQ T FT + ++ C+T RN R Sbjct: 155 VYNSNKGSVRVHPSDNSGSLNCRKQTNQTTAFTWPGVVNLTWKRGCQTMRNMR 207 >SB_43606| Best HMM Match : Y_phosphatase (HMM E-Value=3.9e-26) Length = 280 Score = 28.7 bits (61), Expect = 4.0 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = -2 Query: 489 VAQSNHRNVDI*SFSNGLMVLCRVQYNQETRFTECSLNLVSKSTWCETPRNRR 331 V SN +V + N + CR Q NQ T FT + ++ C+T RN R Sbjct: 196 VYNSNKGSVRVHPSDNSGSLNCRKQTNQTTAFTWPGVVNLTWKRGCQTMRNMR 248 >SB_57493| Best HMM Match : Surf_Ag_VNR (HMM E-Value=0.00037) Length = 432 Score = 28.3 bits (60), Expect = 5.2 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +1 Query: 415 LDPAQDHQPITEASYVNIPVIALCNTDSPLR 507 LDP +HQPIT+ + I ++A TD+PL+ Sbjct: 119 LDPDVEHQPITDRAEACICLVA---TDAPLK 146 >SB_1986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 989 Score = 27.9 bits (59), Expect = 6.9 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 412 VLDPAQDHQPITEASYVNIPVIALCNTDSPLRLWTL 519 +L PA+ QP+ E + VI+ C L LWTL Sbjct: 399 LLLPAEFTQPVEEPQTEALEVISACLDQGNLGLWTL 434 >SB_53468| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) Length = 583 Score = 27.5 bits (58), Expect = 9.1 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +3 Query: 420 PCTRPSTH---Y*SFICQHSCDCFVQHRLPTKIVDIAIPCNTKSSHSI 554 PC+ +H Y + H C F+ H K + +A PC+ SH + Sbjct: 276 PCSPFLSHDAIYKALFLAHPCSPFLSHDAIYKALFLAYPCSPFLSHDV 323 >SB_49920| Best HMM Match : MANEC (HMM E-Value=0.73) Length = 139 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +1 Query: 154 CLQTTC*WYPCD-QLASYLGKTCSGCSC 234 C+Q C CD + SY G+TC G +C Sbjct: 87 CVQRCCDVLHCDLAMMSYGGRTCYGVAC 114 >SB_44668| Best HMM Match : 7tm_1 (HMM E-Value=6.1e-05) Length = 1604 Score = 27.5 bits (58), Expect = 9.1 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +3 Query: 270 HLITALRSACCTEVCRAHRCYAYCGAF 350 + + + R + T++ R HRC YC F Sbjct: 1549 YALVSPRESIATDIHRVHRCIGYCPQF 1575 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,371,145 Number of Sequences: 59808 Number of extensions: 515918 Number of successful extensions: 1369 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1165 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1365 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1512078125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -