BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00461 (723 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ315986-1|ABC48733.1| 442|Drosophila melanogaster bag of marbl... 29 4.8 DQ315990-1|ABC48737.1| 442|Drosophila melanogaster bag of marbl... 29 6.4 DQ315983-1|ABC48730.1| 442|Drosophila melanogaster bag of marbl... 29 6.4 DQ315981-1|ABC48728.1| 442|Drosophila melanogaster bag of marbl... 29 6.4 >DQ315986-1|ABC48733.1| 442|Drosophila melanogaster bag of marbles protein. Length = 442 Score = 29.5 bits (63), Expect = 4.8 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +3 Query: 39 QQLQATSKTYLEHLAIFLAGNEEREKIAPRSAYE--QRDDVSSINGV 173 QQL K EHLA+ + GNE + YE DD + +GV Sbjct: 15 QQLDHXFKQMEEHLALMVEGNENEDPRKATCEYEDTNEDDATCTSGV 61 >DQ315990-1|ABC48737.1| 442|Drosophila melanogaster bag of marbles protein. Length = 442 Score = 29.1 bits (62), Expect = 6.4 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 39 QQLQATSKTYLEHLAIFLAGNEEREKIAPRSAYEQRDD 152 QQL K EHLA+ + GNE + S YE ++ Sbjct: 15 QQLDHNFKQMEEHLALMVEGNENEDPRKATSEYEDTNE 52 >DQ315983-1|ABC48730.1| 442|Drosophila melanogaster bag of marbles protein. Length = 442 Score = 29.1 bits (62), Expect = 6.4 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 39 QQLQATSKTYLEHLAIFLAGNEEREKIAPRSAYEQRDD 152 QQL K EHLA+ + GNE + S YE ++ Sbjct: 15 QQLDHNFKQMEEHLALMVEGNENEDPRKATSEYEDTNE 52 >DQ315981-1|ABC48728.1| 442|Drosophila melanogaster bag of marbles protein. Length = 442 Score = 29.1 bits (62), Expect = 6.4 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 39 QQLQATSKTYLEHLAIFLAGNEEREKIAPRSAYEQRDD 152 QQL K EHLA+ + GNE + S YE ++ Sbjct: 15 QQLDHNFKQMEEHLALMVEGNENEDPRKATSEYEDTNE 52 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,765,283 Number of Sequences: 53049 Number of extensions: 553442 Number of successful extensions: 1126 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1093 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1126 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3231892257 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -