BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00461 (723 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 2.2 L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 23 2.9 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 5.1 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 5.1 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 5.1 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 5.1 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.4 bits (48), Expect = 2.2 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = +2 Query: 392 YIPDNPC*CHCSSD--PSIAR*TNIKKNMKI--FFNVLLRIS 505 YI NP C+CS D P I T+ ++ +I NV+ R S Sbjct: 676 YIGGNPFNCNCSMDWLPGINNQTSTREYPRIMDLDNVMCRTS 717 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 23.0 bits (47), Expect = 2.9 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +1 Query: 448 INQHKKKHENIFQCSTSN 501 +N H K H N++Q +N Sbjct: 32 LNSHLKSHSNVYQYRCAN 49 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 22.2 bits (45), Expect = 5.1 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +3 Query: 381 NCKNIFPITLVSVTVV 428 N KNIFP+ V + V+ Sbjct: 3 NMKNIFPVLFVIINVL 18 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.2 bits (45), Expect = 5.1 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +1 Query: 13 GEANLRSCCSSCRPHPKLTWSI 78 G + C +S P P++TW + Sbjct: 408 GPSMFLKCVASGNPTPEITWEL 429 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 5.1 Identities = 8/28 (28%), Positives = 16/28 (57%) Frame = +1 Query: 13 GEANLRSCCSSCRPHPKLTWSI*PYSWP 96 G A C ++ P P++TW++ ++ P Sbjct: 436 GPAVSLKCSAAGNPTPQVTWALDGFALP 463 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 5.1 Identities = 8/28 (28%), Positives = 16/28 (57%) Frame = +1 Query: 13 GEANLRSCCSSCRPHPKLTWSI*PYSWP 96 G A C ++ P P++TW++ ++ P Sbjct: 436 GPAVSLKCSAAGNPTPQVTWALDGFALP 463 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,020 Number of Sequences: 438 Number of extensions: 3838 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -