BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00455 (731 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 pr... 25 2.4 AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease pr... 25 3.2 AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor O... 24 4.2 AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembran... 24 4.2 AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembran... 24 4.2 AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18... 24 5.6 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 23 7.4 DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domai... 23 9.7 AY045760-1|AAK84942.1| 165|Anopheles gambiae D7-related 1 prote... 23 9.7 AJ133852-1|CAB39727.1| 165|Anopheles gambiae D7-related 1 prote... 23 9.7 >AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 protein. Length = 105 Score = 25.0 bits (52), Expect = 2.4 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +1 Query: 397 TAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENS 501 T FI VVG F KY E R + F A N+ Sbjct: 48 TLVFIPVVGIHFDPKYFPEPERFDPERFSAANRNN 82 >AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease protein. Length = 435 Score = 24.6 bits (51), Expect = 3.2 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 165 SGGKTSTRALECLCRATE 112 +GGK+ST+ EC RA E Sbjct: 91 NGGKSSTKGKECRTRAGE 108 >AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor Or83b protein. Length = 478 Score = 24.2 bits (50), Expect = 4.2 Identities = 16/62 (25%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = +2 Query: 74 LSTIDRELLKPSASVALHK-HSNALVDVLPPEADSSISMLQADEKPDVQYSDIGGMDTQK 250 L I R L++ SAS+ ++ +S+ L + + S + ++ ++ PDV+ D+ G+ + K Sbjct: 232 LKGIMRSLMELSASLDTYRPNSSQLFRAISAGSKSEL-IINEEKDPDVKDFDLSGIYSSK 290 Query: 251 QE 256 + Sbjct: 291 AD 292 >AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 331 Score = 24.2 bits (50), Expect = 4.2 Identities = 16/62 (25%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = +2 Query: 74 LSTIDRELLKPSASVALHK-HSNALVDVLPPEADSSISMLQADEKPDVQYSDIGGMDTQK 250 L I R L++ SAS+ ++ +S+ L + + S + ++ ++ PDV+ D+ G+ + K Sbjct: 85 LKGIMRSLMELSASLDTYRPNSSQLFRAISAGSKSEL-IINEEKDPDVKDFDLSGIYSSK 143 Query: 251 QE 256 + Sbjct: 144 AD 145 >AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 478 Score = 24.2 bits (50), Expect = 4.2 Identities = 16/62 (25%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = +2 Query: 74 LSTIDRELLKPSASVALHK-HSNALVDVLPPEADSSISMLQADEKPDVQYSDIGGMDTQK 250 L I R L++ SAS+ ++ +S+ L + + S + ++ ++ PDV+ D+ G+ + K Sbjct: 232 LKGIMRSLMELSASLDTYRPNSSQLFRAISAGSKSEL-IINEEKDPDVKDFDLSGIYSSK 290 Query: 251 QE 256 + Sbjct: 291 AD 292 >AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18D protein. Length = 380 Score = 23.8 bits (49), Expect = 5.6 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -1 Query: 344 PYMSTPRGGSIPICRYNST 288 PY RG I +C Y++T Sbjct: 37 PYSKCKRGNRITVCSYSAT 55 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 23.4 bits (48), Expect = 7.4 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -1 Query: 77 REYGHNNLSQWCCQLCLYF 21 RE G NN W C+ C F Sbjct: 73 RELGRNNQLLWLCKNCNEF 91 >DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domain polypeptide protein. Length = 168 Score = 23.0 bits (47), Expect = 9.7 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 323 GGSIPICRYNST*VRGSSTASLILVFVYPCL 231 G IP C + + +STA L + V PCL Sbjct: 83 GKCIPKCSNENMPLSKTSTAILFVRLVTPCL 113 >AY045760-1|AAK84942.1| 165|Anopheles gambiae D7-related 1 protein protein. Length = 165 Score = 23.0 bits (47), Expect = 9.7 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = -3 Query: 159 GKTSTRALECLCRATEADGFNNSLSIVERIR 67 GK + +CL +T D F VE ++ Sbjct: 108 GKRANAYYKCLVESTSGDAFKKVFDTVELVK 138 >AJ133852-1|CAB39727.1| 165|Anopheles gambiae D7-related 1 protein protein. Length = 165 Score = 23.0 bits (47), Expect = 9.7 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = -3 Query: 159 GKTSTRALECLCRATEADGFNNSLSIVERIR 67 GK + +CL +T D F VE ++ Sbjct: 108 GKRANAYYKCLVESTSGDAFKKVFDTVELVK 138 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 770,309 Number of Sequences: 2352 Number of extensions: 14503 Number of successful extensions: 28 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -