BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00453 (649 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 22 3.8 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 21 6.6 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 22.2 bits (45), Expect = 3.8 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +2 Query: 137 FVRYPASRYKVFKLILNLCYLIALQHQQVKYV 232 ++ S+YK +L++ LC L H+ K + Sbjct: 195 YIEESISKYKHAELVMPLCKSCDLHHRLSKLI 226 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 21.4 bits (43), Expect = 6.6 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +2 Query: 80 NYPYSTRKKILSLMTSHQYFVRYPASRYKVFKLILNLCYLI 202 ++ + + K + + +TS Y S YK FK+ + L LI Sbjct: 54 HFTFKSWKVLYTSLTSFGYLFCASLSFYKAFKIGILLNQLI 94 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 468 TFFQANVMHGSIFWC 424 +FF A +H FWC Sbjct: 1014 SFFIAACLHPQEFWC 1028 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 468 TFFQANVMHGSIFWC 424 +FF A +H FWC Sbjct: 1014 SFFIAACLHPQEFWC 1028 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 468 TFFQANVMHGSIFWC 424 +FF A +H FWC Sbjct: 1014 SFFIAACLHPQEFWC 1028 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 468 TFFQANVMHGSIFWC 424 +FF A +H FWC Sbjct: 1014 SFFIAACLHPQEFWC 1028 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,523 Number of Sequences: 336 Number of extensions: 3401 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -