BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00453 (649 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0079 - 27539389-27539892,27540059-27540343,27540453-275405... 40 0.002 >05_07_0079 - 27539389-27539892,27540059-27540343,27540453-27540550, 27540951-27541042,27541155-27541259,27541360-27541567, 27542469-27542472,27542742-27542765,27545025-27546266 Length = 853 Score = 39.5 bits (88), Expect = 0.002 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +3 Query: 327 VKTILPLRQVKVEYDQFELKRKLLTQHDFIMVDTRILSHASHLLGKMFF 473 V ++PL ++ +Y +E +R+L HD + D +L +LGK F+ Sbjct: 111 VSEVIPLSALRTDYRPYESRRRLAASHDLFIADRAVLPLLPRVLGKAFY 159 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,614,233 Number of Sequences: 37544 Number of extensions: 314899 Number of successful extensions: 714 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 700 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 714 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -