BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00453 (649 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF000266-6|AAC71167.1| 228|Caenorhabditis elegans Hypothetical ... 28 5.0 U97007-6|AAB52296.3| 468|Caenorhabditis elegans Hypothetical pr... 28 6.6 >AF000266-6|AAC71167.1| 228|Caenorhabditis elegans Hypothetical protein W08F4.3 protein. Length = 228 Score = 28.3 bits (60), Expect = 5.0 Identities = 9/33 (27%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = +3 Query: 498 VRLQANVTLRKPLKLV-YACSSPFKYWNNINHS 593 V + + ++L +PL ++ + + YWNN++H+ Sbjct: 180 VHVTSGISLGEPLSVIQFYMKQAYNYWNNLSHT 212 >U97007-6|AAB52296.3| 468|Caenorhabditis elegans Hypothetical protein ZC196.4 protein. Length = 468 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +1 Query: 100 KKNTILDDESPIFCEISCI 156 K+NTI DD+ P FCE S I Sbjct: 147 KENTIEDDKKPDFCEYSNI 165 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,287,568 Number of Sequences: 27780 Number of extensions: 316097 Number of successful extensions: 780 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 760 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 780 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1434198608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -