BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00451 (755 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 24 1.5 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 6.1 AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 21 8.0 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 21 8.0 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.8 bits (49), Expect = 1.5 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +1 Query: 466 ICLYKYPILC*H*MC*DYFKFCSLINVTR*L*LHCTYHF 582 +C+Y + + +C YF +I L L C YHF Sbjct: 131 LCIYYFVVPLFFLLCIYYFYCAFIIFTVHLLFLLCIYHF 169 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -2 Query: 319 LIFTIHFIYLEHQFIFKLFTLIT*LY 242 +IFT+HF+ + F + L+ Y Sbjct: 90 IIFTVHFLLCTYYFYYAFIILLCVYY 115 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = -1 Query: 668 FILY*HFFITPIFSNRSTYYIF 603 F+L ++F+ P+F YY + Sbjct: 129 FLLCIYYFVVPLFFLLCIYYFY 150 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -2 Query: 457 SKSKINPMTVQIKLLFYFKQIHQHQYLYKYIECST 353 + +I T +I ++ K + QH Y+ I C T Sbjct: 490 TSEEIRQFTQEINIM---KSVRQHPYIVSLIGCVT 521 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -2 Query: 652 ISLLHLYFQIGVLTTF 605 I L +LYF + V++TF Sbjct: 217 IQLYYLYFDVIVISTF 232 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -2 Query: 652 ISLLHLYFQIGVLTTF 605 I L +LYF + V++TF Sbjct: 143 IQLYYLYFDVIVISTF 158 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,883 Number of Sequences: 336 Number of extensions: 3857 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -