BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00451 (755 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY359054-1|AAQ89413.1| 255|Homo sapiens ATWD578 protein. 32 1.9 AK124779-1|BAC85944.1| 163|Homo sapiens protein ( Homo sapiens ... 31 5.9 >AY359054-1|AAQ89413.1| 255|Homo sapiens ATWD578 protein. Length = 255 Score = 32.3 bits (70), Expect = 1.9 Identities = 17/63 (26%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 460 YSKSKINPMTVQIKLLFYFKQIHQHQYLYKYIECSTSLKSWLQQLTTLIFTIHFIYL--E 287 Y+ + M++ I L+F+ +I ++++ +TSL+SW+ + + F + + L E Sbjct: 134 YAAMVFHYMSITI-LVFFMMEIIFKLFVFRLSSFTTSLRSWMPVVVVVSFILDIVLLFQE 192 Query: 286 HQF 278 HQF Sbjct: 193 HQF 195 >AK124779-1|BAC85944.1| 163|Homo sapiens protein ( Homo sapiens cDNA FLJ42789 fis, clone BRAWH3007221. ). Length = 163 Score = 30.7 bits (66), Expect = 5.9 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = -2 Query: 442 NPMTVQIKLLFYFKQIHQHQYLYKYIEC-STSLKSWLQQLTTLIFTIHFIYLEHQFIFKL 266 +P+++ + LLF F + +L C ++SL +L + +F HF+YL F+L Sbjct: 45 HPLSLSVSLLFLFS-VSPSDHLTPLACCLASSLSPFLSLFVSSLFLTHFLYLAASPCFRL 103 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,917,391 Number of Sequences: 237096 Number of extensions: 1818333 Number of successful extensions: 2759 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2356 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2759 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 9127122082 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -