BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00450 (810 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF127647-1|ABL74413.1| 213|Anopheles gambiae Rab5 protein. 57 7e-10 AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small... 44 6e-06 >EF127647-1|ABL74413.1| 213|Anopheles gambiae Rab5 protein. Length = 213 Score = 56.8 bits (131), Expect = 7e-10 Identities = 32/87 (36%), Positives = 51/87 (58%), Gaps = 2/87 (2%) Frame = +3 Query: 522 GKSALTVQFVSGCFMEKYDPTI-EDFYRKEIEVDNSPCVLEILDTAGTEQFASMRDLYIK 698 GKS+L ++FV G F E + TI F + + +D++ EI DTAG E++ S+ +Y + Sbjct: 36 GKSSLVLRFVKGQFHEYQESTIGAAFLTQTLCIDDTTVKFEIWDTAGQERYHSLAPMYYR 95 Query: 699 NGQGFVVVYSINKPPNVSRHQT-MKEL 776 Q +VVY I + +R +T +KEL Sbjct: 96 GAQAAIVVYDIQNSDSFARAKTWVKEL 122 >AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small GTPase protein. Length = 190 Score = 44.0 bits (99), Expect = 6e-06 Identities = 23/76 (30%), Positives = 36/76 (47%) Frame = +3 Query: 513 GFRGKSALTVQFVSGCFMEKYDPTIEDFYRKEIEVDNSPCVLEILDTAGTEQFASMRDLY 692 G GK+ + + + + F +Y PT D Y + VD L + DTAG E + +R L Sbjct: 15 GTVGKTCMLISYTTDSFPGEYVPTSFDNYSAPMVVDGVQVSLGLWDTAGQEDYDRLRPLS 74 Query: 693 IKNGQGFVVVYSINKP 740 F++ YS+ P Sbjct: 75 YPQTDVFLICYSVASP 90 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 793,981 Number of Sequences: 2352 Number of extensions: 16141 Number of successful extensions: 33 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 85655418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -