BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00449 (751 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory recept... 23 2.0 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 23 2.0 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 21 8.0 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 21 8.0 >AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory receptor candidate 18 protein. Length = 387 Score = 23.4 bits (48), Expect = 2.0 Identities = 14/59 (23%), Positives = 29/59 (49%) Frame = +2 Query: 497 ILSTKIITTNPTIVKGNATYENLVSYVNEIKQNIEDRWKERQNVLNDLQNDIAQLHSRI 673 ++STK++ + A +E + + ++ I+QN + R Q V + Q+HS + Sbjct: 172 LISTKLLAHFLILTVLKARFEAINNIIDSIRQNSQTR---NQAVPTGTIKTLVQMHSNL 227 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 23.4 bits (48), Expect = 2.0 Identities = 14/59 (23%), Positives = 29/59 (49%) Frame = +2 Query: 497 ILSTKIITTNPTIVKGNATYENLVSYVNEIKQNIEDRWKERQNVLNDLQNDIAQLHSRI 673 ++STK++ + A +E + + ++ I+QN + R Q V + Q+HS + Sbjct: 172 LISTKLLAHFLILTVLKARFEAINNIIDSIRQNSQTR---NQAVPTGTIKTLVQMHSNL 227 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 470 LVRDNVENFILSTKII 517 LV DN +N ++S KI+ Sbjct: 204 LVSDNAKNALISEKIV 219 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 21.4 bits (43), Expect = 8.0 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -3 Query: 200 LTLHAIPSKFSALCSSILNEVSSKGTSFCLNFTI 99 +T A+ + L +SIL +VSS FC + + Sbjct: 55 VTFFALSELLTDLATSILLKVSSLLIGFCASIYV 88 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,994 Number of Sequences: 336 Number of extensions: 3272 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -