BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00448 (738 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g15020.1 68418.m01761 paired amphipathic helix repeat-contain... 34 0.11 At3g09170.1 68416.m01088 Ulp1 protease family protein contains P... 33 0.20 At1g34610.1 68414.m04301 Ulp1 protease family protein contains P... 33 0.20 At1g22450.1 68414.m02806 cytochrome c oxidase subunit 6b, putati... 33 0.26 At5g19900.1 68418.m02368 PRLI-interacting factor, putative stron... 32 0.35 At3g50550.1 68416.m05528 expressed protein isoform contains a n... 31 1.1 At5g23950.1 68418.m02812 C2 domain-containing protein similar to... 30 1.4 At3g01320.1 68416.m00045 paired amphipathic helix repeat-contain... 30 1.4 At5g26730.1 68418.m03166 expressed protein ; expression support... 30 1.8 At1g20970.1 68414.m02625 adhesin-related contains TIGRFAM TIGR01... 30 1.8 At5g66540.1 68418.m08389 expressed protein ; supported by full-L... 29 2.4 At5g04460.1 68418.m00443 expressed protein 29 3.2 At4g26380.1 68417.m03795 DC1 domain-containing protein contains ... 29 3.2 At1g30650.1 68414.m03748 WRKY family transcription factor contai... 29 3.2 At4g32330.2 68417.m04600 expressed protein 29 4.3 At4g32330.1 68417.m04599 expressed protein 29 4.3 At3g51070.1 68416.m05592 dehydration-responsive protein-related ... 29 4.3 At1g80000.2 68414.m09359 expressed protein identical to unknown ... 29 4.3 At1g80000.1 68414.m09358 expressed protein identical to unknown ... 29 4.3 At5g22650.2 68418.m02647 expressed protein non-consensus AT dono... 28 5.6 At5g22650.1 68418.m02646 expressed protein non-consensus AT dono... 28 5.6 At3g13780.1 68416.m01739 expressed protein 28 5.6 At5g55920.1 68418.m06975 nucleolar protein, putative similar to ... 28 7.4 At4g26600.1 68417.m03834 nucleolar protein, putative similar to ... 28 7.4 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 28 7.4 At1g48380.1 68414.m05404 root hair initiation protein root hairl... 28 7.4 At1g12650.1 68414.m01469 expressed protein similar to KED (GI:80... 28 7.4 At5g43560.2 68418.m05326 meprin and TRAF homology domain-contain... 27 9.8 At5g43560.1 68418.m05325 meprin and TRAF homology domain-contain... 27 9.8 At5g18360.1 68418.m02160 disease resistance protein (TIR-NBS-LRR... 27 9.8 At4g21660.1 68417.m03138 proline-rich spliceosome-associated (PS... 27 9.8 At4g02740.1 68417.m00374 F-box family protein contains Pfam PF00... 27 9.8 At3g04610.1 68416.m00493 KH domain-containing protein similar pu... 27 9.8 At2g22795.1 68415.m02704 expressed protein 27 9.8 At1g62450.1 68414.m07046 Rho GDP-dissociation inhibitor family p... 27 9.8 >At5g15020.1 68418.m01761 paired amphipathic helix repeat-containing protein similar to transcription co-repressor Sin3 [Xenopus laevis] GI:4960210; contains Pfam profile PF02671: Paired amphipathic helix repeat Length = 1377 Score = 33.9 bits (74), Expect = 0.11 Identities = 30/108 (27%), Positives = 50/108 (46%), Gaps = 3/108 (2%) Frame = +3 Query: 273 AQEEHPVVEQG--NADAEDEMDIDETASGAMNEESAYIGDNCLSTPADTEENSPQNDQDN 446 A+ EH V +G + DA+DE D + +G + IGD C EE ++ D Sbjct: 994 AKTEHSVEAEGENDEDADDEDGDDASEAGEDASGTESIGDECSQDDNGVEEEGEHDEIDG 1053 Query: 447 QLDSMIKEPESEEAEGLGDAESLLISLSVLPFYQQIVV*VK-LKEHQA 587 + +S EAEG+ L+ + P +++++ VK L +H A Sbjct: 1054 KAES------EGEAEGM--ESHLIEDKGLFPSSERVLLSVKPLSKHIA 1093 >At3g09170.1 68416.m01088 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 1000 Score = 33.1 bits (72), Expect = 0.20 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = +3 Query: 294 VEQGNADAEDEMDIDETASGAMNEESAYIGDNCLSTPADTEENSPQNDQD 443 V Q D +DEMD+D + A E G+ + ++ P D+D Sbjct: 365 VNQAKGDGDDEMDVDGSGVAAEEREECAAGEGVDGLDGEANKDGPVTDKD 414 >At1g34610.1 68414.m04301 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 997 Score = 33.1 bits (72), Expect = 0.20 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = +3 Query: 294 VEQGNADAEDEMDIDETASGAMNEESAYIGDNCLSTPADTEENSPQNDQD 443 V Q D +DEMD+D + A E G+ + ++ P D+D Sbjct: 365 VNQAKGDGDDEMDVDGSGVAAEEREECAAGEGVDGLDGEANKDGPVTDKD 414 >At1g22450.1 68414.m02806 cytochrome c oxidase subunit 6b, putative (COX6b) nearly identical to subunit 6b of cytochrome c oxidase [Arabidopsis thaliana] GI:6518353 Length = 191 Score = 32.7 bits (71), Expect = 0.26 Identities = 21/72 (29%), Positives = 35/72 (48%) Frame = +3 Query: 273 AQEEHPVVEQGNADAEDEMDIDETASGAMNEESAYIGDNCLSTPADTEENSPQNDQDNQL 452 A+EE PV E+ + E++ + ++ +E A DN TPA EEN+ +N + Sbjct: 52 AKEESPV-EEAVSVVEEKSESAPESTEVASEAPAAAEDNAEETPAAAEENNDENASEEVA 110 Query: 453 DSMIKEPESEEA 488 + E + E A Sbjct: 111 EETPDEIKLETA 122 >At5g19900.1 68418.m02368 PRLI-interacting factor, putative strong similarity to PRLI-interacting factor A [Arabidopsis thaliana] GI:11139262 Length = 494 Score = 32.3 bits (70), Expect = 0.35 Identities = 22/87 (25%), Positives = 39/87 (44%), Gaps = 1/87 (1%) Frame = +3 Query: 249 RRPSIAPPAQEEHPVVE-QGNADAEDEMDIDETASGAMNEESAYIGDNCLSTPADTEENS 425 RR +A A EE VVE + +D +D D SG E D C+ A + + Sbjct: 352 RRDMVAQDANEE--VVENESESDGDDTGGSDARTSGETKENHVAAEDVCMQDVAARDNEA 409 Query: 426 PQNDQDNQLDSMIKEPESEEAEGLGDA 506 + +N S+ + ++++ G+G + Sbjct: 410 VVKENNNNSKSVDEVKANKQSVGVGSS 436 >At3g50550.1 68416.m05528 expressed protein isoform contains a non-consensus AT donor site at intron 1 Length = 95 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 2/65 (3%) Frame = +3 Query: 297 EQGNADAEDEMDIDETASGAMNEESA--YIGDNCLSTPADTEENSPQNDQDNQLDSMIKE 470 E+ + D +D+ D D +S +EE GD+ S+ D +++ +D D++ D +E Sbjct: 15 EEYDEDDDDDDDTDGESSDEDDEEEDRNLSGDDSESSEDDYTDSNSDSDDDDEEDDDDEE 74 Query: 471 PESEE 485 E EE Sbjct: 75 EEEEE 79 Score = 28.7 bits (61), Expect = 4.3 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 6/74 (8%) Frame = +3 Query: 318 EDEMDIDETASGAMNEESA-----YIGDNCLSTPAD-TEENSPQNDQDNQLDSMIKEPES 479 ED+ D D+T + +E+ GD+ S+ D T+ NS +D D + D E E Sbjct: 19 EDDDDDDDTDGESSDEDDEEEDRNLSGDDSESSEDDYTDSNSDSDDDDEEDDD--DEEEE 76 Query: 480 EEAEGLGDAESLLI 521 EE + L D + L+ Sbjct: 77 EEEDSLVDKVTRLL 90 >At5g23950.1 68418.m02812 C2 domain-containing protein similar to cold-regulated gene SRC2 [Glycine max] GI:2055230; contains Pfam profile PF00168: C2 domain Length = 219 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +2 Query: 557 GVGEVEGAPSVQDDESSTMDEDIAEGGVASSDDVND 664 GV EG +V+ DE D+D A A DD +D Sbjct: 176 GVALAEGLEAVEGDEDDDDDDDAAAAAAADDDDDDD 211 >At3g01320.1 68416.m00045 paired amphipathic helix repeat-containing protein low similarity to transcription co-repressor Sin3 [Xenopus laevis] GI:4960210; contains Pfam profile PF02671: Paired amphipathic helix repeat Length = 1378 Score = 30.3 bits (65), Expect = 1.4 Identities = 31/98 (31%), Positives = 46/98 (46%), Gaps = 1/98 (1%) Frame = +3 Query: 297 EQGNADAEDEMDIDETASGAMNEESAYIGDNCLSTPADTEENSPQNDQDNQLDSMIKEPE 476 E N D D++D E AS A ES GD C EEN ++ D + +S Sbjct: 1005 EVENEDDADDVD-SENASEASGTESG--GDVCSQDEDREEENGEHDEIDGKAES------ 1055 Query: 477 SEEAEGLGDAESLLISLSVLPFYQQIVV*VK-LKEHQA 587 EAEG+ D L +LP +++++ V+ L +H A Sbjct: 1056 EGEAEGM-DPHLLEGESELLPQSERVLLSVRPLSKHVA 1092 >At5g26730.1 68418.m03166 expressed protein ; expression supported by MPSS Length = 268 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/52 (30%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +3 Query: 447 QLDSMIKEPESEEAEGLGDA-ESLLISLSVLPFYQQIVV*VKLKEHQAFKMM 599 +L+++ +EPE+EE E LGD+ + +L+ + + +V K+K + F M+ Sbjct: 37 RLETIEEEPEAEERERLGDSHKPMLVKAKMKVEKGKSIVKAKVKSGKVFYML 88 >At1g20970.1 68414.m02625 adhesin-related contains TIGRFAM TIGR01612: reticulocyte binding protein; contains TIGRFAM TIGR00864: polycystin cation channel protein; similar to fimbriae-associated protein Fap1 [Streptococcus parasanguinis] (GI:3929312) Length = 1498 Score = 29.9 bits (64), Expect = 1.8 Identities = 22/76 (28%), Positives = 41/76 (53%), Gaps = 4/76 (5%) Frame = +3 Query: 291 VVEQGNADAEDEMDIDETASGAMNEESAYIGDNCLST-PADTEENSPQNDQDNQ--LDSM 461 VVE GN+ +E E ++ GA+++ S + D ++T P + + P DQ + + S Sbjct: 375 VVENGNSKSESEDSKMQSEIGAVDDGS--VSDGSINTHPESQDASDPTCDQGGKQHISSE 432 Query: 462 IKEP-ESEEAEGLGDA 506 +KE ++ +E + DA Sbjct: 433 VKEVLDAPASEEISDA 448 >At5g66540.1 68418.m08389 expressed protein ; supported by full-Length cDNA gi:12057175 from [Arabidopsis thaliana] Length = 524 Score = 29.5 bits (63), Expect = 2.4 Identities = 20/68 (29%), Positives = 34/68 (50%) Frame = +3 Query: 312 DAEDEMDIDETASGAMNEESAYIGDNCLSTPADTEENSPQNDQDNQLDSMIKEPESEEAE 491 D DEMD+D S +++E I N + + EE +++++ + +E E EE E Sbjct: 109 DDIDEMDMDGFDSDDVDDEDKEIESN--DSEGEDEEEEEEDEEEEE-----EEEEEEEEE 161 Query: 492 GLGDAESL 515 GD E + Sbjct: 162 KDGDNEGI 169 >At5g04460.1 68418.m00443 expressed protein Length = 863 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +3 Query: 384 DNCLSTPADTEENSPQNDQDNQLDSMIKEPESEEAEGLGDAES 512 D C+S + + ++P+ D+DN+ D +++ E EG AES Sbjct: 34 DECISFGSCSSVHNPE-DEDNEDDQLVRRRRRSELEGDNLAES 75 >At4g26380.1 68417.m03795 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 1016 Score = 29.1 bits (62), Expect = 3.2 Identities = 22/81 (27%), Positives = 41/81 (50%), Gaps = 2/81 (2%) Frame = +3 Query: 321 DEMDIDETASGAMNEESAY--IGDNCLSTPADTEENSPQNDQDNQLDSMIKEPESEEAEG 494 + MD+D S + G + ST +D+E +S +N + DS+ EPE E Sbjct: 385 NSMDLDSQPRPLRKVVSVFSQYGFDVNSTVSDSESDSSENYVSHIKDSLKLEPEPELISF 444 Query: 495 LGDAESLLISLSVLPFYQQIV 557 + SL+IS++ P +++++ Sbjct: 445 IHRIGSLVISMN--PNWEKLI 463 >At1g30650.1 68414.m03748 WRKY family transcription factor contains Pfam profile: PF03106 WRKY DNA -binding domain Length = 430 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +1 Query: 58 SDPATHSDSHDGAEVSPQADNQDNQVADTIDDLPDNNSASDDVTTEPEEL 207 S A + D E+ D+ DNQ+A +L D+ DD + EEL Sbjct: 331 SSSAIKDERGDDMELENVDDDDDNQIAPYRPELHDHQHQPDDFFADLEEL 380 >At4g32330.2 68417.m04600 expressed protein Length = 436 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +3 Query: 270 PAQEEHPVVEQGNADAEDEMDIDETASGAMNEESA 374 P +EE V NAD ED ET S MNE+ A Sbjct: 391 PTEEEAQVTVSSNADVEDS---HETVSPRMNEDRA 422 >At4g32330.1 68417.m04599 expressed protein Length = 437 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +3 Query: 270 PAQEEHPVVEQGNADAEDEMDIDETASGAMNEESA 374 P +EE V NAD ED ET S MNE+ A Sbjct: 392 PTEEEAQVTVSSNADVEDS---HETVSPRMNEDRA 423 >At3g51070.1 68416.m05592 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 895 Score = 28.7 bits (61), Expect = 4.3 Identities = 23/81 (28%), Positives = 35/81 (43%), Gaps = 4/81 (4%) Frame = +3 Query: 279 EEHPVVEQGNADA-EDEMDIDETASGAMNEESAY-IGDNCLSTPADTEENSPQNDQD--N 446 +E P VEQGN E + + D T + A +E G S + EEN +Q+ N Sbjct: 191 KEQPDVEQGNKQGQEQDSNTDVTFTDATKQEQPMETGQGETSETSKNEENGQPEEQNSGN 250 Query: 447 QLDSMIKEPESEEAEGLGDAE 509 + E ++ +E G E Sbjct: 251 EETGQQNEEKTTASEENGKGE 271 >At1g80000.2 68414.m09359 expressed protein identical to unknown protein GB:AAD55481 [Arabidopsis thaliana] Length = 605 Score = 28.7 bits (61), Expect = 4.3 Identities = 18/62 (29%), Positives = 24/62 (38%), Gaps = 2/62 (3%) Frame = +1 Query: 49 KMESDPATHSDSHDGAEVSPQADNQDNQVADTIDDLPDNNSASD--DVTTEPEELAANGG 222 K+ + HSD H G V DN+ + D+ D D D V E +A N Sbjct: 44 KLRAAIQIHSDEHSGVVVVDSDDNEGLHIEDSYGDDDDEEEDGDYGQVDDHVEYIADNND 103 Query: 223 PT 228 T Sbjct: 104 KT 105 >At1g80000.1 68414.m09358 expressed protein identical to unknown protein GB:AAD55481 [Arabidopsis thaliana] Length = 605 Score = 28.7 bits (61), Expect = 4.3 Identities = 18/62 (29%), Positives = 24/62 (38%), Gaps = 2/62 (3%) Frame = +1 Query: 49 KMESDPATHSDSHDGAEVSPQADNQDNQVADTIDDLPDNNSASD--DVTTEPEELAANGG 222 K+ + HSD H G V DN+ + D+ D D D V E +A N Sbjct: 44 KLRAAIQIHSDEHSGVVVVDSDDNEGLHIEDSYGDDDDEEEDGDYGQVDDHVEYIADNND 103 Query: 223 PT 228 T Sbjct: 104 KT 105 >At5g22650.2 68418.m02647 expressed protein non-consensus AT donor splice site at exon 3, AC acceptor splice site at exon 4; Length = 223 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/64 (25%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +3 Query: 252 RPSIAPPAQEEHPVVEQGNADAEDEMDIDETASGAMN-EESAYIGDNCLSTPADTEENSP 428 +P+ PA+E+ E+ +D EDE + D+ + M+ +E D + + EE +P Sbjct: 58 KPAEVKPAEEKPESDEEDESDDEDESEEDDDSEKGMDVDEDDSDDDEEEDSEDEEEEETP 117 Query: 429 QNDQ 440 + + Sbjct: 118 KKPE 121 >At5g22650.1 68418.m02646 expressed protein non-consensus AT donor splice site at exon 3, AC acceptor splice site at exon 4; Length = 306 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/64 (25%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +3 Query: 252 RPSIAPPAQEEHPVVEQGNADAEDEMDIDETASGAMN-EESAYIGDNCLSTPADTEENSP 428 +P+ PA+E+ E+ +D EDE + D+ + M+ +E D + + EE +P Sbjct: 141 KPAEVKPAEEKPESDEEDESDDEDESEEDDDSEKGMDVDEDDSDDDEEEDSEDEEEEETP 200 Query: 429 QNDQ 440 + + Sbjct: 201 KKPE 204 >At3g13780.1 68416.m01739 expressed protein Length = 309 Score = 28.3 bits (60), Expect = 5.6 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = +3 Query: 297 EQGNADAEDEMDIDETASG-AMNEESAYIGDNCLSTPADTEENSPQNDQDNQLDSMIKEP 473 ++G AD E+E D DET G +++E A + + EE ++D D++ D +E Sbjct: 257 QRGRADVEEEDDDDETLGGFIVSDEEAKL--------EEEEEEEDESDVDDEEDEDEEEE 308 Query: 474 E 476 E Sbjct: 309 E 309 >At5g55920.1 68418.m06975 nucleolar protein, putative similar to SP|P46087 Proliferating-cell nucleolar antigen p120 (Proliferation-associated nucleolar protein p120) {Homo sapiens}, SP|P40991 Nucleolar protein NOP2 {Saccharomyces cerevisiae}; contains Pfam profile PF01189: NOL1/NOP2/sun family Length = 682 Score = 27.9 bits (59), Expect = 7.4 Identities = 19/80 (23%), Positives = 36/80 (45%), Gaps = 2/80 (2%) Frame = +3 Query: 279 EEHPVVEQGNADAE--DEMDIDETASGAMNEESAYIGDNCLSTPADTEENSPQNDQDNQL 452 E++ V + + D E D D D+ + +EE D + ++ +ND++ Sbjct: 64 EDYEVTDDSDEDDEVSDGSDEDDISPAVESEEIDESDDGENGSNQLFSDDEEENDEETLG 123 Query: 453 DSMIKEPESEEAEGLGDAES 512 D ++ E+ EG DA+S Sbjct: 124 DDFLEGSGDEDEEGSLDADS 143 >At4g26600.1 68417.m03834 nucleolar protein, putative similar to SP|P46087 Proliferating-cell nucleolar antigen p120 (Proliferation-associated nucleolar protein p120) {Homo sapiens}; contains Pfam profile PF01189: NOL1/NOP2/sun family Length = 671 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/79 (20%), Positives = 34/79 (43%) Frame = +3 Query: 267 PPAQEEHPVVEQGNADAEDEMDIDETASGAMNEESAYIGDNCLSTPADTEENSPQNDQDN 446 PP +++ + + + E+ DE NE+S ++ +D +E + D+ Sbjct: 37 PPLKKQRKCISEKKPLKKPEVSTDEEEEEEENEQSDEGSESGSDLFSDGDEEGNNDSDDD 96 Query: 447 QLDSMIKEPESEEAEGLGD 503 D + + E+AE L + Sbjct: 97 DDDDDDDDDDDEDAEPLAE 115 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 27.9 bits (59), Expect = 7.4 Identities = 18/72 (25%), Positives = 35/72 (48%) Frame = +3 Query: 276 QEEHPVVEQGNADAEDEMDIDETASGAMNEESAYIGDNCLSTPADTEENSPQNDQDNQLD 455 QE+H +V + + E+E++++E A +E IGD E+ ++D D+ Sbjct: 137 QEDHELVNEEGEELEEEIEVEEEAGEFADE----IGDG-------AEDLDSEDDDDDHAI 185 Query: 456 SMIKEPESEEAE 491 +K E+ + E Sbjct: 186 EEVKHGETVDVE 197 >At1g48380.1 68414.m05404 root hair initiation protein root hairless 1 (RHL1) Length = 355 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/65 (24%), Positives = 28/65 (43%) Frame = +3 Query: 234 QRCFGRRPSIAPPAQEEHPVVEQGNADAEDEMDIDETASGAMNEESAYIGDNCLSTPADT 413 QR G++ + A + E +GN EDE + E S + E + G+ ++ + Sbjct: 250 QRNSGKKFNFAETSSEASSGESEGNTSDEDEKPLLEPESSTRSREESQDGNGITASASKL 309 Query: 414 EENSP 428 E P Sbjct: 310 PEELP 314 >At1g12650.1 68414.m01469 expressed protein similar to KED (GI:8096269) [Nicotiana tabacum]; similar to rRNA processing protein EBP2 (SP:P36049) [Saccharomyces cerevisiae] Length = 248 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +2 Query: 557 GVGEVEGAPSVQDDESSTMDEDIAEGGVASSDD 655 G G+ EG+ S E S DED++ V+SSD+ Sbjct: 3 GAGKFEGSSSKIVFEDSEEDEDLSCSSVSSSDE 35 >At5g43560.2 68418.m05326 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 1055 Score = 27.5 bits (58), Expect = 9.8 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +2 Query: 554 SGVGEVEGAPSVQDDESSTMDEDIAEGGVASSDDVNDI**CRT 682 +GV E +G S DD SST D + GVA+ ++ C++ Sbjct: 558 NGVAERKGL-STMDDSSSTCSNDSIQSGVANGSYKGNVLNCQS 599 >At5g43560.1 68418.m05325 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 1055 Score = 27.5 bits (58), Expect = 9.8 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +2 Query: 554 SGVGEVEGAPSVQDDESSTMDEDIAEGGVASSDDVNDI**CRT 682 +GV E +G S DD SST D + GVA+ ++ C++ Sbjct: 558 NGVAERKGL-STMDDSSSTCSNDSIQSGVANGSYKGNVLNCQS 599 >At5g18360.1 68418.m02160 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 900 Score = 27.5 bits (58), Expect = 9.8 Identities = 15/59 (25%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Frame = +2 Query: 53 WNRTLLLTAI--LTMARKCRLKPITRITRLPILSMICLTIIQQVTM*PLSLRNLLRMVV 223 W T L ++ + +++ LK I +++ + +CL+ + M P S++NL ++VV Sbjct: 623 WEGTQPLRSLKQMDLSKSENLKEIPDLSKAVNIEELCLSYCGSLVMLPSSIKNLNKLVV 681 >At4g21660.1 68417.m03138 proline-rich spliceosome-associated (PSP) family protein similar to SP|Q13435 Splicing factor 3B subunit 2 (Spliceosome associated protein 145) (SAP 145) (SF3b150) (Pre-mRNA splicing factor SF3b 145 kDa subunit) {Homo sapiens}; contains Pfam profiles PF04046: PSP, PF04037: Domain of unknown function (DUF382) Length = 584 Score = 27.5 bits (58), Expect = 9.8 Identities = 21/85 (24%), Positives = 37/85 (43%), Gaps = 3/85 (3%) Frame = +3 Query: 276 QEEHPVVEQGNADAEDEMDIDETASGAMNEESAYIGDNCLSTPADTEENSPQ-NDQDNQL 452 +EE E+ + E+EMD +E G + ++ + TP E Q + D L Sbjct: 410 EEEEEEEEEEEEEQEEEMDEEELEDGTESVDTLSSTPTGIETPDAIELRKDQRKEPDRAL 469 Query: 453 DSMIKEPESEEAEG--LGDAESLLI 521 +++E A G LG + + +I Sbjct: 470 YQVLEEKGESVAPGTLLGTSHTYVI 494 >At4g02740.1 68417.m00374 F-box family protein contains Pfam PF00646: F-box domain; similar to F-box protein FBL2 (GI:6063090) [Homo sapiens] Length = 645 Score = 27.5 bits (58), Expect = 9.8 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = +3 Query: 405 ADTEENSPQNDQDNQLDSMIKEPESEEAEGLG---DAESLLISLSVL 536 A+ +E ++D D+ D + E ESE + +G D + LL+ VL Sbjct: 335 AEDDEVDEEDDSDDDTDDVSDEDESENDDDMGMGFDVDYLLVQGQVL 381 >At3g04610.1 68416.m00493 KH domain-containing protein similar putative nucleic acid binding protein GB:CAB39665 [Arabidopsis thaliana]; Pfam HMM hit: KH domain family of RNA binding proteins Length = 577 Score = 27.5 bits (58), Expect = 9.8 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Frame = +1 Query: 79 DSHDGAEVSPQADNQDNQVADTIDDLPDNNSASDDV----TTEPEELAANGG 222 ++HD A+ Q D QD+ + D + D + + +EPEE A GG Sbjct: 124 EAHDQAQYQAQGDVQDHNGDEVQDKVEDEEGIPEHLESLQKSEPEEDATVGG 175 >At2g22795.1 68415.m02704 expressed protein Length = 734 Score = 27.5 bits (58), Expect = 9.8 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 3/63 (4%) Frame = +3 Query: 309 ADAEDEMDIDETASGAMNEESAYIGDNCLSTPA-DTEENSPQNDQDNQLD--SMIKEPES 479 ++ E DIDE A+ E+ Y GD+ S ++EE + +++ +++ S IK E Sbjct: 280 SEESKEKDIDEKANIEEARENNYKGDDASSEVVHESEEKTSESENSEKVEDKSGIKTEEV 339 Query: 480 EEA 488 E++ Sbjct: 340 EDS 342 >At1g62450.1 68414.m07046 Rho GDP-dissociation inhibitor family protein similar to SP|P52565 Rho GDP-dissociation inhibitor 1 (Rho GDI 1) (Rho-GDI alpha) {Homo sapiens}; contains Pfam profile PF02115: RHO protein GDP dissociation inhibitor Length = 223 Score = 27.5 bits (58), Expect = 9.8 Identities = 23/66 (34%), Positives = 32/66 (48%) Frame = +3 Query: 318 EDEMDIDETASGAMNEESAYIGDNCLSTPADTEENSPQNDQDNQLDSMIKEPESEEAEGL 497 EDEM E ASG +E+ N S+ + TE++ D+ +L MI E E + Sbjct: 4 EDEMKKGE-ASGETSEKMGLSRKNSGSSLSPTEDDEEDEDKKLELGPMIALKEQLERD-- 60 Query: 498 GDAESL 515 D ESL Sbjct: 61 KDDESL 66 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,834,898 Number of Sequences: 28952 Number of extensions: 255230 Number of successful extensions: 1131 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 1042 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1129 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1624036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -