BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00445 (405 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 2.3 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 20 9.3 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 2.3 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +1 Query: 166 PFQLASCTFHIREVHSGHSGLRQDL*HCFWNITQGGIGYNFVNLRMKSER 315 P L + T +RE+H ++GLR DL + + + N R+ S+R Sbjct: 277 PEGLFASTRDLREIHLAYNGLR-DLPKGIFTRLEQLLVLNLAGNRLGSDR 325 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 20.2 bits (40), Expect = 9.3 Identities = 6/22 (27%), Positives = 12/22 (54%) Frame = +1 Query: 166 PFQLASCTFHIREVHSGHSGLR 231 P+ + +CT HI G + ++ Sbjct: 167 PYDILNCTIHIASWSHGSNEIK 188 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,668 Number of Sequences: 438 Number of extensions: 2250 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10132494 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -