BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00443 (410 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_O96054 Cluster: MBF2; n=3; Bombycoidea|Rep: MBF2 - Sami... 96 3e-19 UniRef50_UPI00015B4849 Cluster: PREDICTED: similar to protease, ... 34 1.3 UniRef50_Q6BVX3 Cluster: Similar to sp|Q08908 Saccharomyces cere... 34 1.3 UniRef50_UPI0000DB7674 Cluster: PREDICTED: hypothetical protein;... 33 2.3 UniRef50_A0LLA0 Cluster: Metallophosphoesterase; n=1; Syntrophob... 33 2.3 UniRef50_A6E8I8 Cluster: Putative uncharacterized protein; n=2; ... 33 3.0 UniRef50_Q4Q726 Cluster: Putative uncharacterized protein; n=5; ... 33 3.0 UniRef50_Q2TZG0 Cluster: Ankyrin repeat; n=1; Aspergillus oryzae... 33 3.0 UniRef50_UPI000049882B Cluster: snRNA activating protein complex... 32 4.0 UniRef50_Q5NLD7 Cluster: Putative uncharacterized protein; n=3; ... 32 4.0 UniRef50_UPI000023CA60 Cluster: hypothetical protein FG02117.1; ... 32 5.2 UniRef50_A4WA59 Cluster: Diguanylate cyclase/phosphodiesterase p... 32 5.2 UniRef50_Q4YSU4 Cluster: Putative uncharacterized protein; n=4; ... 32 5.2 UniRef50_UPI00015B4E38 Cluster: PREDICTED: similar to nubbin; n=... 31 6.9 UniRef50_Q81RH4 Cluster: Amidase family protein; n=10; Bacillus|... 31 6.9 UniRef50_A7NTV4 Cluster: Chromosome chr18 scaffold_1, whole geno... 31 6.9 UniRef50_A7TJG6 Cluster: Putative uncharacterized protein; n=1; ... 31 6.9 UniRef50_A6QVD0 Cluster: Predicted protein; n=1; Ajellomyces cap... 31 9.1 >UniRef50_O96054 Cluster: MBF2; n=3; Bombycoidea|Rep: MBF2 - Samia cynthia (Cynthia moth) (Ailanthus silkmoth) Length = 113 Score = 95.9 bits (228), Expect = 3e-19 Identities = 38/65 (58%), Positives = 55/65 (84%) Frame = +1 Query: 61 ECGHLFVGTNINRPMVYHHNAKYDSKLFRKRVENLHYVLPQVPSTIGKSIQGILAYDKTH 240 +C H F+GT++ RP++YHH+ +Y SK+F+KRVENL++ LP VP+ G++IQGILAYDKT+ Sbjct: 17 DCTHTFLGTSVLRPLIYHHDVQYSSKIFKKRVENLYFSLPSVPTNYGRTIQGILAYDKTN 76 Query: 241 TTASA 255 + ASA Sbjct: 77 SGASA 81 Score = 38.3 bits (85), Expect = 0.060 Identities = 14/20 (70%), Positives = 19/20 (95%) Frame = +3 Query: 255 NITQGGIGFTFVNLRMKSER 314 N+TQGG+G+ F+NLRMKS+R Sbjct: 82 NVTQGGLGYNFMNLRMKSDR 101 >UniRef50_UPI00015B4849 Cluster: PREDICTED: similar to protease, reverse transcriptase, ribonuclease H, integrase; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to protease, reverse transcriptase, ribonuclease H, integrase - Nasonia vitripennis Length = 1501 Score = 33.9 bits (74), Expect = 1.3 Identities = 20/60 (33%), Positives = 26/60 (43%), Gaps = 7/60 (11%) Frame = +2 Query: 119 TLSTTPS-YSAKGLRTFITFYPRCHPPLASPFRAFWPMIRLTP------PLPQHHSRWNR 277 T S P+ Y+ KG F+ C P SP + WP+ R P P P H +W R Sbjct: 439 TQSQPPNQYNKKGSTQFVGACYHCQQPKPSPVSSLWPIRRNFPELWKLCPNPNHVGKWQR 498 >UniRef50_Q6BVX3 Cluster: Similar to sp|Q08908 Saccharomyces cerevisiae YOR384w FRE5 ferric reductase; n=1; Debaryomyces hansenii|Rep: Similar to sp|Q08908 Saccharomyces cerevisiae YOR384w FRE5 ferric reductase - Debaryomyces hansenii (Yeast) (Torulaspora hansenii) Length = 633 Score = 33.9 bits (74), Expect = 1.3 Identities = 16/55 (29%), Positives = 30/55 (54%) Frame = +1 Query: 127 YDSKLFRKRVENLHYVLPQVPSTIGKSIQGILAYDKTHTTASATSLKVESDSLSS 291 Y++ +F N+HY P VPS I +++ ++A DK+ + S + D L++ Sbjct: 554 YEASIFDLSNINIHYRRPDVPSLIDEAVSNMIAEDKSSSYKSLAVVGCGPDLLTN 608 >UniRef50_UPI0000DB7674 Cluster: PREDICTED: hypothetical protein; n=2; Eumetazoa|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 441 Score = 33.1 bits (72), Expect = 2.3 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +2 Query: 113 ITTLSTTPSYSAKGLRTFITFYPRCH-PPLASPFRAFWPMIRLTPPLP 253 ITT TTP+Y+ T+ TFYP PP P P + +T P P Sbjct: 337 ITTPITTPTYTPSS--TYPTFYPSTRPPPYLPPSTPSTPRVTVTAPPP 382 >UniRef50_A0LLA0 Cluster: Metallophosphoesterase; n=1; Syntrophobacter fumaroxidans MPOB|Rep: Metallophosphoesterase - Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) Length = 303 Score = 33.1 bits (72), Expect = 2.3 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 Query: 261 TQGGIGFTFVNLRMKSERETSLITMSTSTFKYC 359 T GG+G + V +R +E E S+IT+ T K C Sbjct: 267 TSGGVGVSGVPVRFATEGEVSVITLKRKTLKVC 299 >UniRef50_A6E8I8 Cluster: Putative uncharacterized protein; n=2; Bacteria|Rep: Putative uncharacterized protein - Pedobacter sp. BAL39 Length = 353 Score = 32.7 bits (71), Expect = 3.0 Identities = 18/65 (27%), Positives = 29/65 (44%) Frame = +2 Query: 116 TTLSTTPSYSAKGLRTFITFYPRCHPPLASPFRAFWPMIRLTPPLPQHHSRWNRIHFRQS 295 T L T+ + + F+ F RC L R++ ++ +TP + + R I F Q Sbjct: 179 TRLETSKFNQIRICKEFVKFNERCFIRLLGDMRSYNYVVHITPDIEGNQYRIRAIDFDQQ 238 Query: 296 PYEER 310 YE R Sbjct: 239 SYEGR 243 >UniRef50_Q4Q726 Cluster: Putative uncharacterized protein; n=5; Trypanosomatidae|Rep: Putative uncharacterized protein - Leishmania major Length = 325 Score = 32.7 bits (71), Expect = 3.0 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +2 Query: 233 RLTPPLPQHHSRWNRIHFRQSPYEERTRNKLN 328 ++ PPLP+ H+ W R R SPY++R ++N Sbjct: 291 KIEPPLPRSHTTW-RSSSRSSPYQQRRAVEVN 321 >UniRef50_Q2TZG0 Cluster: Ankyrin repeat; n=1; Aspergillus oryzae|Rep: Ankyrin repeat - Aspergillus oryzae Length = 802 Score = 32.7 bits (71), Expect = 3.0 Identities = 21/66 (31%), Positives = 34/66 (51%) Frame = +1 Query: 88 NINRPMVYHHNAKYDSKLFRKRVENLHYVLPQVPSTIGKSIQGILAYDKTHTTASATSLK 267 NIN ++HH YD + R+RVE LH L T+ K+ + I Y+ + + L+ Sbjct: 55 NINSFGIFHHE-NYD--ILRQRVEELHNQLAPKSKTLSKT-KDINCYELENILKAVIELR 110 Query: 268 VESDSL 285 +S+ L Sbjct: 111 KDSEKL 116 >UniRef50_UPI000049882B Cluster: snRNA activating protein complex subunit; n=1; Entamoeba histolytica HM-1:IMSS|Rep: snRNA activating protein complex subunit - Entamoeba histolytica HM-1:IMSS Length = 342 Score = 32.3 bits (70), Expect = 4.0 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +1 Query: 61 ECGHLFVGTNINRPMVYHHNAKYDSKLFRKRVE 159 +C H+F+ ++I P+ N KY +FRKR E Sbjct: 260 DCEHIFIVSDIRVPLQEDKNGKYPRIIFRKRKE 292 >UniRef50_Q5NLD7 Cluster: Putative uncharacterized protein; n=3; Alphaproteobacteria|Rep: Putative uncharacterized protein - Zymomonas mobilis Length = 576 Score = 32.3 bits (70), Expect = 4.0 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +1 Query: 67 GHLFVGTNINRPMVYHHNAKYDSKLF 144 G FVGTN ++ ++H N YD++L+ Sbjct: 294 GWYFVGTNTDKQAIFHDNQDYDTRLY 319 >UniRef50_UPI000023CA60 Cluster: hypothetical protein FG02117.1; n=1; Gibberella zeae PH-1|Rep: hypothetical protein FG02117.1 - Gibberella zeae PH-1 Length = 509 Score = 31.9 bits (69), Expect = 5.2 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +2 Query: 224 PMIRLTPPLPQHHSRWNRIHFRQSPYEERTRNKLNYDVY 340 P++ LP ++RW Q+ YEERT+ LN ++Y Sbjct: 220 PLVGFFITLPTRYNRWKIQKHIQTLYEERTKRLLNPELY 258 >UniRef50_A4WA59 Cluster: Diguanylate cyclase/phosphodiesterase precursor; n=1; Enterobacter sp. 638|Rep: Diguanylate cyclase/phosphodiesterase precursor - Enterobacter sp. 638 Length = 720 Score = 31.9 bits (69), Expect = 5.2 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 1/68 (1%) Frame = +1 Query: 67 GHLFVGTNINRPMVYHHNAKYDSKLFRKRVENLHYVLPQVPSTIGKSIQ-GILAYDKTHT 243 G FVG + RPMV K D R+ + ++ PQ+ S +G + Q L + + HT Sbjct: 171 GVAFVGIGLIRPMVGRLQVKND---VRRYLVITRHINPQILSDLGNTFQIENLHFTRDHT 227 Query: 244 TASATSLK 267 + S+ LK Sbjct: 228 SESSIPLK 235 >UniRef50_Q4YSU4 Cluster: Putative uncharacterized protein; n=4; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 541 Score = 31.9 bits (69), Expect = 5.2 Identities = 13/49 (26%), Positives = 28/49 (57%) Frame = +1 Query: 94 NRPMVYHHNAKYDSKLFRKRVENLHYVLPQVPSTIGKSIQGILAYDKTH 240 N ++Y+H K+ F K V+N++ ++P + GK +QG++ + + Sbjct: 212 NSKVLYNHYFKHPFNKFTK-VKNIYPIIPHISGWKGKYVQGVMEIESAN 259 >UniRef50_UPI00015B4E38 Cluster: PREDICTED: similar to nubbin; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to nubbin - Nasonia vitripennis Length = 649 Score = 31.5 bits (68), Expect = 6.9 Identities = 19/54 (35%), Positives = 26/54 (48%) Frame = +2 Query: 107 STITTLSTTPSYSAKGLRTFITFYPRCHPPLASPFRAFWPMIRLTPPLPQHHSR 268 +T TTL+ TP+ + G T +PR PP +P A P +R L H R Sbjct: 45 TTTTTLTPTPTTAGSGATTPAVTHPRLSPPALAP--ASTPDLRSPSALHVKHLR 96 >UniRef50_Q81RH4 Cluster: Amidase family protein; n=10; Bacillus|Rep: Amidase family protein - Bacillus anthracis Length = 491 Score = 31.5 bits (68), Expect = 6.9 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 79 VGTNINRPMVYHHNAKYDSKLFRKRVENL 165 +G N P Y+ + +YD KLF+K +E L Sbjct: 283 IGVYSNAPKEYYESGEYDEKLFKKTIEVL 311 >UniRef50_A7NTV4 Cluster: Chromosome chr18 scaffold_1, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr18 scaffold_1, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 802 Score = 31.5 bits (68), Expect = 6.9 Identities = 20/69 (28%), Positives = 29/69 (42%) Frame = +1 Query: 88 NINRPMVYHHNAKYDSKLFRKRVENLHYVLPQVPSTIGKSIQGILAYDKTHTTASATSLK 267 N+ R H AK DS+L + RVE + + S K+ L K A+ LK Sbjct: 264 NLERAQTEEHQAKQDSELAKLRVEEMEQGIADEASVAAKA---QLEVAKARHAAAVADLK 320 Query: 268 VESDSLSSI 294 D L ++ Sbjct: 321 AVKDELEAL 329 >UniRef50_A7TJG6 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 739 Score = 31.5 bits (68), Expect = 6.9 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = +2 Query: 203 SPFRAFWPMIRLTPPLPQHHSRWNRIHFRQSPYE 304 SPF++F P++ P+P HH +++ F Q+P++ Sbjct: 284 SPFQSFSPIVHPHSPIPMHH---HQMQFPQNPHQ 314 >UniRef50_A6QVD0 Cluster: Predicted protein; n=1; Ajellomyces capsulatus NAm1|Rep: Predicted protein - Ajellomyces capsulatus NAm1 Length = 146 Score = 31.1 bits (67), Expect = 9.1 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = +2 Query: 89 ISIDLWSTITTLSTTPSYSAKGLRTFITFYPRCH 190 +S D W+ I ++ YSAKGL T IT Y CH Sbjct: 16 LSRDAWTIIDIVADR--YSAKGLNTTITDYFECH 47 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 377,105,440 Number of Sequences: 1657284 Number of extensions: 7353182 Number of successful extensions: 19509 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 19064 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19504 length of database: 575,637,011 effective HSP length: 92 effective length of database: 423,166,883 effective search space used: 18619342852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -