BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00440 (550 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC21C3.13 |rps1901|rps19-1|40S ribosomal protein S19|Schizosac... 92 4e-20 SPBC649.02 |rps1902|rps19-2, rps19|40S ribosomal protein S19|Sch... 91 1e-19 SPAC17G8.14c |pck1|SPAC22H10.01c|protein kinase C |Schizosacchar... 25 5.6 SPBC27B12.05 |||WD repeat protein|Schizosaccharomyces pombe|chr ... 25 9.7 >SPBC21C3.13 |rps1901|rps19-1|40S ribosomal protein S19|Schizosaccharomyces pombe|chr 2|||Manual Length = 144 Score = 92.3 bits (219), Expect = 4e-20 Identities = 40/70 (57%), Positives = 51/70 (72%) Frame = +2 Query: 44 MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAI 223 M V+VKDV+ K + AA LK++GK+ P+ +D+VKT KELAPYDPDW+YVR AAI Sbjct: 1 MAGVSVKDVDAQKFITAYAAFLKRSGKMTTPQWIDIVKTGTHKELAPYDPDWYYVRAAAI 60 Query: 224 LRHIYIRSPV 253 RHIY+R V Sbjct: 61 ARHIYLRKQV 70 Score = 65.7 bits (153), Expect = 4e-12 Identities = 30/63 (47%), Positives = 43/63 (68%) Frame = +1 Query: 256 VKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILTTQGRRDL 435 V + K++GG G+ PSH SGS+ RK +QSLE + ++EK +GGR ++ QG+RDL Sbjct: 72 VGRLCKVYGGSVNRGMRPSHHRDGSGSVQRKVVQSLEKIGVLEKSDNGGRRISQQGQRDL 131 Query: 436 DRI 444 DRI Sbjct: 132 DRI 134 >SPBC649.02 |rps1902|rps19-2, rps19|40S ribosomal protein S19|Schizosaccharomyces pombe|chr 2|||Manual Length = 143 Score = 91.1 bits (216), Expect = 1e-19 Identities = 39/70 (55%), Positives = 51/70 (72%) Frame = +2 Query: 44 MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAI 223 M V+VKDV+ + + AA LK++GK+ P+ +D+VKT KELAPYDPDW+YVR AAI Sbjct: 1 MAGVSVKDVDAQQFINAYAAFLKRSGKMTTPQWIDIVKTGTHKELAPYDPDWYYVRAAAI 60 Query: 224 LRHIYIRSPV 253 RHIY+R V Sbjct: 61 ARHIYLRKQV 70 Score = 65.7 bits (153), Expect = 4e-12 Identities = 30/63 (47%), Positives = 43/63 (68%) Frame = +1 Query: 256 VKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILTTQGRRDL 435 V + K++GG G+ PSH SGS+ RK +QSLE + ++EK +GGR ++ QG+RDL Sbjct: 72 VGRLCKVYGGSVNRGMRPSHHRDGSGSVQRKVVQSLEKIGVLEKSDNGGRRISQQGQRDL 131 Query: 436 DRI 444 DRI Sbjct: 132 DRI 134 >SPAC17G8.14c |pck1|SPAC22H10.01c|protein kinase C |Schizosaccharomyces pombe|chr 1|||Manual Length = 988 Score = 25.4 bits (53), Expect = 5.6 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 159 QLASKSWLRMTLIGSMCVVL 218 +L SKSWL + +G +C+ L Sbjct: 359 KLLSKSWLSLEPVGQICISL 378 >SPBC27B12.05 |||WD repeat protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 391 Score = 24.6 bits (51), Expect = 9.7 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 4/35 (11%) Frame = -2 Query: 432 VSSTLCGENATT----VLNFLNKLQCLQRLQSLAC 340 VSS C E T L+ +N ++C+ LQS+ C Sbjct: 261 VSSKNCFEEPITPRFQALHRINMIECIPELQSVVC 295 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,982,677 Number of Sequences: 5004 Number of extensions: 37760 Number of successful extensions: 105 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 227943826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -