BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00440 (550 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54531| Best HMM Match : Ribosomal_S19e (HMM E-Value=5e-30) 68 6e-12 SB_9755| Best HMM Match : Sushi (HMM E-Value=0) 29 3.3 SB_9024| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_38875| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_38543| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_37662| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 >SB_54531| Best HMM Match : Ribosomal_S19e (HMM E-Value=5e-30) Length = 92 Score = 67.7 bits (158), Expect = 6e-12 Identities = 32/57 (56%), Positives = 39/57 (68%) Frame = +1 Query: 274 IFGGRKRNGVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILTTQGRRDLDRI 444 I GRK G PSHF S S+AR L+ LE +KLVEK GGR +T+QG+RD+DRI Sbjct: 32 IRAGRKNRGSAPSHFEVGSASVARSVLKGLEQIKLVEKASTGGRNITSQGQRDMDRI 88 Score = 58.8 bits (136), Expect = 3e-09 Identities = 21/32 (65%), Positives = 29/32 (90%) Frame = +2 Query: 116 TGKVKVPEHMDLVKTARFKELAPYDPDWFYVR 211 +G +K+P+ +DLVKT +FKELAPYDPDW+Y+R Sbjct: 2 SGNLKIPDWVDLVKTGKFKELAPYDPDWYYIR 33 >SB_9755| Best HMM Match : Sushi (HMM E-Value=0) Length = 1351 Score = 28.7 bits (61), Expect = 3.3 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +3 Query: 312 TFLQVIRQYCTQGFAIVGGIEAC*ESSGRWS 404 TF ++ C +GF ++G +S+G+WS Sbjct: 21 TFPNTVKFMCDEGFNLIGSRNRTCQSNGKWS 51 >SB_9024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 455 Score = 28.7 bits (61), Expect = 3.3 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +3 Query: 312 TFLQVIRQYCTQGFAIVGGIEAC*ESSGRWS 404 TF ++ C +GF ++G +S+G+WS Sbjct: 286 TFPNTVKFMCDEGFNLIGSRNRTCQSNGKWS 316 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +3 Query: 312 TFLQVIRQYCTQGFAIVGG-IEAC*ESSGRWS 404 TF + C +GF ++G + +C +SSG+WS Sbjct: 112 TFPNKVTFSCDEGFILIGSPLRSC-QSSGKWS 142 >SB_38875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1116 Score = 28.3 bits (60), Expect = 4.4 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = +3 Query: 156 RQLASKSWLRMTLIGSMCV-VLPSFVIFTFAHLLSKDCDQDLWWAQT*WSNTFTFLQVIR 332 RQ++S S TL+ ++CV VL + F S+D D+ +T W N L Sbjct: 833 RQISSGSKPARTLVAALCVIVLAGAELIDFLDCSSRDVSSDM--IRT-WINQSKSLDPTS 889 Query: 333 QYC 341 +YC Sbjct: 890 EYC 892 >SB_38543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 28.3 bits (60), Expect = 4.4 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +1 Query: 67 C*TRQDC*NCRCSLKKNGQSQGT*AHGSCKDSSLQRAGSV 186 C QDC + RC +KNG + T A G CK S + ++ Sbjct: 301 CNCMQDCSSSRCFWRKNG-IECTPACGQCKGSDCTNSPAI 339 >SB_37662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 433 Score = 28.3 bits (60), Expect = 4.4 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +3 Query: 222 SFVIFTFAHLLSKDCDQDLWWA 287 S +++ A +SKDC+ LWWA Sbjct: 81 SVLMYELAWKMSKDCNDLLWWA 102 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,576,887 Number of Sequences: 59808 Number of extensions: 309373 Number of successful extensions: 706 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 649 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 706 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -