BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00439 (741 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0551 - 22027441-22028224,22029015-22029344,22029510-220297... 30 2.2 09_04_0484 + 17990020-17990488,17990930-17991009,17991122-179915... 29 5.1 02_02_0146 - 7171656-7172044,7172383-7175008 28 6.8 04_03_0475 - 16343083-16344213,16344394-16345380,16345467-16345571 28 9.0 >06_03_0551 - 22027441-22028224,22029015-22029344,22029510-22029778, 22030530-22031453,22037761-22038360,22040049-22040267 Length = 1041 Score = 29.9 bits (64), Expect = 2.2 Identities = 21/79 (26%), Positives = 33/79 (41%), Gaps = 2/79 (2%) Frame = +2 Query: 242 CFVQLPAYQSVRQWSAGGPAYLYSFEYVGNLSKGSYFLPGL--ALTDNSNDMKVYENKMK 415 C V + +SV AG + S + + F A T+N N +V E + Sbjct: 235 CIVVITTQESVAVHCAGANGLVCSITCLQATAASDLFQQAFQEAFTNNRNMFEVQEFQRN 294 Query: 416 GPAHGDELAYIFEPLDTEE 472 G ++ + YIFE + EE Sbjct: 295 GDSYEETFRYIFEGDEQEE 313 >09_04_0484 + 17990020-17990488,17990930-17991009,17991122-17991586, 17994670-17994756,17994887-17995018,17995102-17995293, 17995409-17995495,17995621-17996295 Length = 728 Score = 28.7 bits (61), Expect = 5.1 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = +3 Query: 168 YYGSVFNTTLNAVDGLSQIVEATGDALFNFLRTRVFASGAQGVPLI 305 Y+ +V TT+ V+GL IV A+ +FL + +G QGV ++ Sbjct: 558 YFAAVLFTTMMVVEGLMMIV---ASAVPDFLMGIITGAGVQGVMML 600 >02_02_0146 - 7171656-7172044,7172383-7175008 Length = 1004 Score = 28.3 bits (60), Expect = 6.8 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +2 Query: 302 YLYSFEYVGNLSKGSYFLPGLALTDNSNDMKVYENKMKGP 421 YLY G++ KG LP L D++++ NK+ GP Sbjct: 317 YLYYNNLTGSIPKGVSMLPNLT------DIRLFNNKLSGP 350 >04_03_0475 - 16343083-16344213,16344394-16345380,16345467-16345571 Length = 740 Score = 27.9 bits (59), Expect = 9.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 328 PNVFKAI*ISGTPCAPLANTLVRRKLNKASPVAST 224 P+VF A+ S P P T +R + A+PV +T Sbjct: 591 PSVFLALTDSDAPVKPAKRTYKKRAVGSATPVVAT 625 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,788,524 Number of Sequences: 37544 Number of extensions: 406741 Number of successful extensions: 804 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 804 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1957111448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -