BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00437 (731 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 28 0.34 AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. 25 1.8 U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic aci... 24 4.2 L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase pro... 23 7.4 AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase p... 23 7.4 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 9.7 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 27.9 bits (59), Expect = 0.34 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = -1 Query: 524 KPSVVG*FNYIEKNNQYENNIIVTDGCLLTLTRDDNNSPKNY 399 +PS V N + ++N +I G +L + N+SP +Y Sbjct: 838 QPSAVSNSNGLARHNSKSRRLITATGGMLKMPPSSNSSPSSY 879 >AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. Length = 304 Score = 25.4 bits (53), Expect = 1.8 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 295 HHYYSNFCCKSCLEAGQLSPE 357 H YY+N+C SC A + S E Sbjct: 202 HGYYANYCKGSCHLADRFSSE 222 >U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic acid binding protein protein. Length = 388 Score = 24.2 bits (50), Expect = 4.2 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -3 Query: 168 SAWHTYTPLSPTVTRRIVRRETLVP 94 S H YT +PT T R+ R + P Sbjct: 313 STEHRYTTRTPTTTHRLAARTSTPP 337 >L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.4 bits (48), Expect = 7.4 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -3 Query: 60 TPSLDQYTFSGCGYPS 13 TP ++ F GCG+P+ Sbjct: 571 TPQEAEFNFCGCGWPA 586 >AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.4 bits (48), Expect = 7.4 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -3 Query: 60 TPSLDQYTFSGCGYPS 13 TP ++ F GCG+P+ Sbjct: 571 TPQEAEFNFCGCGWPA 586 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.0 bits (47), Expect = 9.7 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = -3 Query: 150 TPLSPTVTRRIVRRETLVPLIHMLS 76 +P SPT +++ R ++ P+ H+L+ Sbjct: 1462 SPASPTPSKKSKRHQSASPIRHILN 1486 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 720,124 Number of Sequences: 2352 Number of extensions: 14909 Number of successful extensions: 25 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -