BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00435X (595 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC4B3.10c |ipk1||inositol 1,3,4,5,6-pentakisphosphate |Schizos... 26 4.8 SPBC26H8.04c |||DEP domain|Schizosaccharomyces pombe|chr 2|||Manual 26 4.8 >SPCC4B3.10c |ipk1||inositol 1,3,4,5,6-pentakisphosphate |Schizosaccharomyces pombe|chr 3|||Manual Length = 640 Score = 25.8 bits (54), Expect = 4.8 Identities = 13/52 (25%), Positives = 23/52 (44%) Frame = +3 Query: 276 LSNLNWQRFTSQAESMIDSQYFSAEIGRTVMSLILNSAGSQYAPSPIKTRIP 431 LSN W+ A + + +Q + +S + ++A S SP+ T P Sbjct: 272 LSNREWEAGKIDAMNSLIAQNLHTSASQVSLSPMASTASSSVTNSPVDTHTP 323 >SPBC26H8.04c |||DEP domain|Schizosaccharomyces pombe|chr 2|||Manual Length = 1496 Score = 25.8 bits (54), Expect = 4.8 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 28 QSVCLLPNKLCDDSLHRHPCCKSNVIVYLHRL 123 + V L+P+ L DD RHP + +V+ ++ L Sbjct: 64 EPVYLMPSPLTDDLKRRHPNLQLSVVSHISSL 95 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,429,880 Number of Sequences: 5004 Number of extensions: 48480 Number of successful extensions: 78 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 258201856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -