BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00434 (832 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 28 0.092 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 24 1.5 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 2.6 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 6.0 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 22 8.0 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 28.3 bits (60), Expect = 0.092 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +1 Query: 211 LRRPRSLYSTVSRSLFEPAEAHRDSGEEPASGQR 312 LRR R L +TV+R+ H DSG ++ QR Sbjct: 248 LRRSRMLTATVNRNHLSGGTNHWDSGRRKSAAQR 281 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +1 Query: 562 CFCTMATLPGQWRRTATPDFIQILTISHAL 651 C C+M LPG +T+T ++ +I+ + + + Sbjct: 684 CNCSMDWLPGINNQTSTREYPRIMDLDNVM 713 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.4 bits (48), Expect = 2.6 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 66 SVSDTPSLKDLPKVATDLKS 125 SVS PS+K + K ATD S Sbjct: 156 SVSCVPSVKHVAKCATDFSS 175 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.2 bits (45), Expect = 6.0 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +3 Query: 474 YSQMYLASIAVFNIDVSQI 530 Y+ + L + + N+DVSQ+ Sbjct: 457 YNDLILPGVTIQNVDVSQL 475 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 21.8 bits (44), Expect = 8.0 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 Query: 536 QIDLTYINIKYGDTSEI 486 QIDL +IN GD EI Sbjct: 172 QIDLKHINQNMGDKVEI 188 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 222,298 Number of Sequences: 438 Number of extensions: 5182 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26581563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -