BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00434 (832 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g10180.1 68416.m01219 kinesin motor protein-related similar t... 33 0.18 At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30)... 33 0.31 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 32 0.41 At4g36520.1 68417.m05185 trichohyalin-related low similarity to ... 31 0.71 At3g28770.1 68416.m03591 expressed protein 30 2.2 At4g31820.1 68417.m04522 phototropic-responsive NPH3 family prot... 29 2.9 At5g64420.1 68418.m08092 DNA polymerase V family contains Pfam d... 29 3.8 At1g23230.1 68414.m02906 expressed protein 29 3.8 At3g45530.1 68416.m04917 DC1 domain-containing protein contains ... 29 5.0 At2g17410.1 68415.m02009 ARID/BRIGHT DNA-binding domain-containi... 29 5.0 At5g60500.1 68418.m07587 undecaprenyl pyrophosphate synthetase f... 28 6.6 At5g11110.1 68418.m01297 sucrose-phosphate synthase, putative si... 28 8.7 At2g02720.1 68415.m00214 pectate lyase family protein similar to... 28 8.7 At1g51900.1 68414.m05850 hypothetical protein 28 8.7 >At3g10180.1 68416.m01219 kinesin motor protein-related similar to centromere protein E GB:4502781 [Homo sapiens] Length = 1348 Score = 33.5 bits (73), Expect = 0.18 Identities = 24/83 (28%), Positives = 37/83 (44%) Frame = +2 Query: 203 RRH*EDPEVFIRRYREVYSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKL 382 ++H ++ + S L H E EK+ + + KEK E TKL Sbjct: 776 QKHETSLKMLSEHHESERSDLLSHIECLEKD-IGSLSSSSLAKEKENLRKDFEK-TKTKL 833 Query: 383 KHTETCEKNSLPTKDVIEQEKSA 451 K TE+ KNS+ K +E EK++ Sbjct: 834 KDTESKLKNSMQDKTKLEAEKAS 856 >At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30) nearly identical to SF2/ASF-like splicing modulator Srp30 [Arabidopsis thaliana] GI:4775270 Length = 268 Score = 32.7 bits (71), Expect = 0.31 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 2/71 (2%) Frame = +1 Query: 97 SPRSPQT*RVSSKASTPAVSVTSTPMKRLCFRLL--KTSPLRRPRSLYSTVSRSLFEPAE 270 SP ++ R S++ P+ S +S R + ++ PL R RSLYS+VSRS Sbjct: 193 SPDDSKSYRSRSRSRGPSCSYSSKSRSVSPARSISPRSRPLSRSRSLYSSVSRSQSRSKS 252 Query: 271 AHRDSGEEPAS 303 R P S Sbjct: 253 RSRSRSNSPVS 263 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 32.3 bits (70), Expect = 0.41 Identities = 31/127 (24%), Positives = 50/127 (39%), Gaps = 4/127 (3%) Frame = +1 Query: 4 LSARIFYPLPHQKYIDSEWPAP*VTLPP*KT----SPRSPQT*RVSSKASTPAVSVTSTP 171 ++ R+ P P + + S PA + PP + SP ++ +P+ S S P Sbjct: 456 VAQRLPSPPPRRAGLPSPPPAQRLPSPPPRRAGLPSPMRIGGSHAANHLESPSPSSLSPP 515 Query: 172 MKRLCFRLLKTSPLRRPRSLYSTVSRSLFEPAEAHRDSGEEPASGQRRYRSGEGKEQIPE 351 ++ ++L + P+RR RSL R H G G GK Sbjct: 516 GRK---KVLPSPPVRRRRSLTPDEERVSLSQGGRHTSPSHIKQDGSMSPVRGRGKSSPSS 572 Query: 352 RHRELRS 372 RH++ RS Sbjct: 573 RHQKARS 579 >At4g36520.1 68417.m05185 trichohyalin-related low similarity to SP|Q07283 Trichohyalin {Homo sapiens} Length = 1400 Score = 31.5 bits (68), Expect = 0.71 Identities = 19/84 (22%), Positives = 36/84 (42%), Gaps = 1/84 (1%) Frame = +2 Query: 245 REVYSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFD-PTKLKHTETCEKNSLPT 421 +E Q+K + +E+N K+ +E + + K +E + +LK T E+N Sbjct: 772 QEEKERQIKERQEREENERRAKEVLEQAENERKLKEALEQKENERRLKETREKEENKKKL 831 Query: 422 KDVIEQEKSAXXXXXXXXXANVSR 493 ++ IE E+ A + R Sbjct: 832 REAIELEEKEKRLIEAFERAEIER 855 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 29.9 bits (64), Expect = 2.2 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Frame = +2 Query: 233 IRRYREVYSSQLKHTETQEKNPLPD-KDAIEAEKEKNKFLNGIENFDPTKLKHTETCEKN 409 +R E K +E EK + KDA E + NK L+ EN D K + E +++ Sbjct: 768 VRNKEENVQGNKKESEKVEKGEKKESKDAKSVETKDNKKLSSTENRDEAKERSGEDNKED 827 Query: 410 SLPTKD 427 +KD Sbjct: 828 KEESKD 833 >At4g31820.1 68417.m04522 phototropic-responsive NPH3 family protein contains NPH3 family domain, Pfam:PF03000 Length = 571 Score = 29.5 bits (63), Expect = 2.9 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 10/92 (10%) Frame = +1 Query: 121 RVSSKASTPAVSVTSTPMKRLCFRLLKTSPLRRPRSLYSTVSRSLFEPAE-AHRDSGEEP 297 +++++AST A P+ R+ ++L LR S ++V+ S P E + GEE Sbjct: 438 KLTNEASTHAAQNERLPL-RVVVQVLYFEQLRANHSPVASVAASSHSPVEKTEENKGEEA 496 Query: 298 AS---------GQRRYRSGEGKEQIPERHREL 366 G + RSG G + +P R R + Sbjct: 497 TKKVELSKKSRGSKSTRSGGGAQLMPSRSRRI 528 >At5g64420.1 68418.m08092 DNA polymerase V family contains Pfam domain PF04931: DNA polymerase V Length = 1306 Score = 29.1 bits (62), Expect = 3.8 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 275 TETQEKNPLPDKDAIEAEKEKNKFLNGIENFD 370 TE E + LPD ++ +K K + +N + N+D Sbjct: 12 TELVENDNLPDSSIVKKKKSKTEKMNTVANYD 43 >At1g23230.1 68414.m02906 expressed protein Length = 1615 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -3 Query: 425 PLWGASSSRTFPCASA*WDRSSRC-RSGICSFPSP 324 PL+G + + P S W+R+ RC R I + PSP Sbjct: 393 PLYGEDLAMSIPKGSLDWERAVRCIRHAIRTTPSP 427 >At3g45530.1 68416.m04917 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 692 Score = 28.7 bits (61), Expect = 5.0 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -2 Query: 471 CYKVVVQADFSCSMT--SFVGSEFFSHVSVCFSLVGSKFSMPF 349 C++ ++ DF C F F+S V F L+ S +MPF Sbjct: 438 CFESIIDDDFLCRACYQMFCEGFFYSSKGVNFDLICSSITMPF 480 >At2g17410.1 68415.m02009 ARID/BRIGHT DNA-binding domain-containing protein contains Pfam profile PF01388: ARID/BRIGHT DNA binding domain Length = 786 Score = 28.7 bits (61), Expect = 5.0 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Frame = +3 Query: 66 SVSDTPSLKDLPKVATDLKSQLEGF---NTSCLRDVDTNEKIVLPSAEDVATEKTQKS 230 S+ + + DLPK+ + SQ E + S +DT E ++ P+AED E S Sbjct: 78 SLEEVTNADDLPKIDDEKNSQFETSPHPSPSPSVALDTEEGLINPTAEDTVEENIVSS 135 >At5g60500.1 68418.m07587 undecaprenyl pyrophosphate synthetase family protein / UPP synthetase family protein contains putative undecaprenyl diphosphate synthase domain [PF01255]; similar to S. cerevisiae dehydrodolichyl diphosphate synthetase (DEDOL-PP synthase)(Rer2)[SP|P35196], a cis-prenyltransferase Length = 271 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = -3 Query: 218 LLSGDVFSRRKHNLFIGVDVTETAGVEAFELTLQVCGDLG 99 ++ G+ +KHNL IG+D AG + + LQ C ++G Sbjct: 41 IMDGNRRFAKKHNL-IGLDAGHRAGFISVKYILQYCKEIG 79 >At5g11110.1 68418.m01297 sucrose-phosphate synthase, putative similar to sucrose-phosphate synthase isoform 1, Citrus unshiu, PIR:S72648 Length = 894 Score = 27.9 bits (59), Expect = 8.7 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +3 Query: 66 SVSDTPS--LKDLPKVATDLKSQLEGFNTSCLRDVDTNEKIVLPSAEDVATEK 218 S SD+PS L+D+ ++ +LK L+G + VDTN AED A E+ Sbjct: 532 SDSDSPSDSLRDINDISLNLKLSLDGEKSGSNNGVDTN-----LDAEDRAAER 579 >At2g02720.1 68415.m00214 pectate lyase family protein similar to pectate lyase P59 SP:P15722 from [Lycopersicon esculentum] Length = 455 Score = 27.9 bits (59), Expect = 8.7 Identities = 16/58 (27%), Positives = 23/58 (39%) Frame = +2 Query: 269 KHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTETCEKNSLPTKDVIEQE 442 K +E P P+ + + EK+ FLNG K KN +P K I + Sbjct: 375 KQVTKREYTPYPEWKSWNWQSEKDYFLNGAYFVQSGKANAWSATPKNPIPRKFAIRPQ 432 >At1g51900.1 68414.m05850 hypothetical protein Length = 774 Score = 27.9 bits (59), Expect = 8.7 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +2 Query: 218 DPEVFIRRYREVYSSQLKHTETQEKNPLPDKDAIEAEK 331 DP+++IR Y E + K + T + + + D+IE K Sbjct: 362 DPDIYIRSYEESPNEVYKFSLTDLEEEIMENDSIEGVK 399 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,044,207 Number of Sequences: 28952 Number of extensions: 365350 Number of successful extensions: 1180 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1180 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1911862400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -