BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00429 (739 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC14G10.02 ||SPCC18B5.13|ribosome biogenesis protein Urb1|Schi... 30 0.40 SPBC30D10.17c |||glucan synthase regulator |Schizosaccharomyces ... 27 2.8 SPCC63.04 |mok14||alpha-1,3-glucan synthase Mok14|Schizosaccharo... 27 3.7 SPCC162.02c |||AMP-binding dehydrogenase |Schizosaccharomyces po... 26 4.9 SPCC4B3.12 |set9||histone lysine methyltransferase Set9|Schizosa... 25 8.5 >SPCC14G10.02 ||SPCC18B5.13|ribosome biogenesis protein Urb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1568 Score = 29.9 bits (64), Expect = 0.40 Identities = 31/118 (26%), Positives = 53/118 (44%) Frame = +2 Query: 257 LSKLPEFKIATQLPKDAEFSLFLPKHQEMANELLGVLMDVPENELQDLLSTCAFARVNLN 436 L +LP+ + QL E L + ++ LL PEN L+ + T F R++L+ Sbjct: 412 LLRLPDSQTFVQLYSSTESDLL---KEGLSRILLYFFTYFPENILKLKIDTSIFLRLDLS 468 Query: 437 PQLFNYCYSVALMHRRDTRKVRVKILQKYFPLNSWIPKYSLKLVKPQLLFHQTFHAYL 610 P + + +S +H + ++IL +Y P W V L++ QT H+ L Sbjct: 469 PGMLDRPFS--RLHVENI----IQIL-RYLPEVKWFDVVRSPFVFLCLMYLQTSHSKL 519 >SPBC30D10.17c |||glucan synthase regulator |Schizosaccharomyces pombe|chr 2|||Manual Length = 504 Score = 27.1 bits (57), Expect = 2.8 Identities = 13/52 (25%), Positives = 28/52 (53%) Frame = +2 Query: 245 TPQDLSKLPEFKIATQLPKDAEFSLFLPKHQEMANELLGVLMDVPENELQDL 400 T D+ L E+++ LP+D SL++ Q+ + G+L V +++++ Sbjct: 155 TVADVDSL-EYELECTLPRDVRESLYIHDGQDRGGQPTGILFGVTLLDIEEI 205 >SPCC63.04 |mok14||alpha-1,3-glucan synthase Mok14|Schizosaccharomyces pombe|chr 3|||Manual Length = 1369 Score = 26.6 bits (56), Expect = 3.7 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = +2 Query: 440 QLFNYCYSVALMHRRDTR-KVRVKILQKYFPLNSWIPKYSLKLVKPQLLFH 589 QL C ++AL + R K+R+ LQ+ FP++ W+ Y +L++ + H Sbjct: 681 QLEKSC-TLALKSTPEMRHKLRIAALQQRFPVDEWVALYD-RLIRNCIKAH 729 >SPCC162.02c |||AMP-binding dehydrogenase |Schizosaccharomyces pombe|chr 3|||Manual Length = 981 Score = 26.2 bits (55), Expect = 4.9 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 123 ITPKGENNSVFQLTEQFLTEDYANNGIE 206 +TP +++ L+E FLT++ NG+E Sbjct: 949 MTPSNGLRNIYPLSETFLTKEAIANGLE 976 >SPCC4B3.12 |set9||histone lysine methyltransferase Set9|Schizosaccharomyces pombe|chr 3|||Manual Length = 441 Score = 25.4 bits (53), Expect = 8.5 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 272 EFKIATQLPKDAEFSLFLPKHQE 340 E A+ D EFSLF+P+H++ Sbjct: 296 ELSDASSSDLDEEFSLFIPRHKK 318 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,060,970 Number of Sequences: 5004 Number of extensions: 63569 Number of successful extensions: 188 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 188 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 349251756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -