BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00425 (734 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ131742-1|CAA10498.1| 590|Caenorhabditis elegans protein ( Cae... 28 6.0 AF098989-4|AAK18956.2| 590|Caenorhabditis elegans Dystrobrevin ... 28 6.0 >AJ131742-1|CAA10498.1| 590|Caenorhabditis elegans protein ( Caenorhabditis elegansmRNA for dystrobrevin. ). Length = 590 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 502 QSCYAE*RNGTNHLHQH-YSCYGTHQEPHYFLSQQRHYSAE*VPRTS 639 QSC+ R NH ++H Y +++ P L H S + +P TS Sbjct: 289 QSCFWRGRTSQNHSNEHEMKEYSSYKSPTKQLVHSIHKSLQCIPATS 335 >AF098989-4|AAK18956.2| 590|Caenorhabditis elegans Dystrobrevin homolog protein 1 protein. Length = 590 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 502 QSCYAE*RNGTNHLHQH-YSCYGTHQEPHYFLSQQRHYSAE*VPRTS 639 QSC+ R NH ++H Y +++ P L H S + +P TS Sbjct: 289 QSCFWRGRTSQNHSNEHEMKEYSSYKSPTKQLVHSIHKSLQCIPATS 335 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,293,054 Number of Sequences: 27780 Number of extensions: 329514 Number of successful extensions: 917 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 877 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 917 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1724918872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -