BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00417 (742 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g22430.1 68417.m03241 hypothetical protein 27 9.9 At2g35040.1 68415.m04299 AICARFT/IMPCHase bienzyme family protei... 27 9.9 >At4g22430.1 68417.m03241 hypothetical protein Length = 348 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +1 Query: 64 LFIRYKEAFKPIYTYPSETG-KASEPPIHPIKVINF 168 +F+ E + P+Y Y SETG + + P+++ NF Sbjct: 104 MFLNKGEMYMPLYVYSSETGFWIHKEVVCPVRLPNF 139 >At2g35040.1 68415.m04299 AICARFT/IMPCHase bienzyme family protein similar to SP|P12048 Bifunctional purine biosynthesis protein purH [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (Inosinicase) (IMP synthetase) (ATIC)] {Bacillus subtilis}; contains Pfam profiles PF01808: AICARFT/IMPCHase bienzyme, PF02142: MGS-like domain Length = 596 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 568 AKRLWLCSNHVSDNIIILIPHN 503 AK WLC HV N I++ +N Sbjct: 485 AKFAWLCVKHVKSNAIVIAKNN 506 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,080,924 Number of Sequences: 28952 Number of extensions: 295284 Number of successful extensions: 500 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 487 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 500 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1633819784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -