BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00416 (754 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46389| Best HMM Match : No HMM Matches (HMM E-Value=.) 108 4e-24 SB_52883| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_19195| Best HMM Match : LEA_4 (HMM E-Value=0.00053) 32 0.57 SB_3451| Best HMM Match : HOK_GEF (HMM E-Value=9.4) 29 4.1 SB_17746| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_4670| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_4188| Best HMM Match : 7tm_1 (HMM E-Value=9e-06) 28 7.1 SB_16274| Best HMM Match : PKD (HMM E-Value=3.5) 28 7.1 SB_10146| Best HMM Match : Collagen (HMM E-Value=0.09) 28 7.1 SB_53390| Best HMM Match : Pox_A32 (HMM E-Value=0.14) 28 9.4 SB_36474| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 >SB_46389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 108 bits (260), Expect = 4e-24 Identities = 46/59 (77%), Positives = 55/59 (93%) Frame = +1 Query: 37 MGAYRYIQELYRKKLSDVMRFLLRVRVWQYRQLTRMHRAPRPTRPDKARRLGYRAKQGY 213 MGAY+Y++ELY+KK SD++RFLLRVR WQYRQLT +HRA RPTRPDKARRLGY+AKQG+ Sbjct: 1 MGAYKYLEELYKKKQSDLLRFLLRVRCWQYRQLTAIHRATRPTRPDKARRLGYKAKQGF 59 Score = 103 bits (248), Expect = 1e-22 Identities = 48/77 (62%), Positives = 56/77 (72%) Frame = +3 Query: 258 VAKGATYGKPKSHGVNQLKPTRNLKSIAEEXXXXXXXXXXXXSSYWVAQDSSYKYFEVIL 437 V KGATYGKP + GVN+LK R+L+S+AEE +SYWV QDS YKYFEVI+ Sbjct: 75 VPKGATYGKPVNQGVNELKFQRSLRSVAEERAGRYCGGLRVLNSYWVGQDSIYKYFEVIM 134 Query: 438 VDPSHKAIRRDPKINWI 488 VDP HKAIRRD +INWI Sbjct: 135 VDPFHKAIRRDARINWI 151 Score = 63.3 bits (147), Expect = 2e-10 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = +2 Query: 509 REMRGLTSAGRSSRGLGKGHRYSQTKGGSRRAAWLRRNTLQLRRKR 646 RE+RGLT+AG +RG+ KGH Y++ G SRRA W R NTL LRR R Sbjct: 159 RELRGLTAAGTKNRGMRKGHNYNKVIGSSRRANWKRHNTLSLRRYR 204 >SB_52883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1434 Score = 33.1 bits (72), Expect = 0.25 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = +3 Query: 126 PSVDSYAPRSQAHKAGQSPKT-RLPC*TRLCCIQNPCATWWPQATVAKGATYGKPKSH 296 P D+ AH+ P T ++PC C QNPC+ P + +TYG P+ + Sbjct: 239 PKTDANGGMQIAHQLPYPPYTGQIPCLPSSCAPQNPCS---PPGCTPQYSTYGYPQGY 293 >SB_19195| Best HMM Match : LEA_4 (HMM E-Value=0.00053) Length = 1152 Score = 31.9 bits (69), Expect = 0.57 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 5/80 (6%) Frame = +3 Query: 84 RCYAFFVA---CEGMA-VPSVDSYAPRSQAHKAGQSPKT-RLPC*TRLCCIQNPCATWWP 248 RCY VA C ++ P +D+ A + P T ++PC C QNPC+ P Sbjct: 702 RCYDINVAGINCRIISHPPKIDTTGGMQMAQQLSYPPYTGQVPCLPSSCTPQNPCS---P 758 Query: 249 QATVAKGATYGKPKSHGVNQ 308 + +T G P++ G Q Sbjct: 759 PGCTPQYSTSGYPQAPGYPQ 778 >SB_3451| Best HMM Match : HOK_GEF (HMM E-Value=9.4) Length = 173 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 94 RFLLRVRVWQYRQLTRMHRAPRPTRPDKARRLGYRAKQ 207 +F ++ YR+ T+MH +RP + R G+R KQ Sbjct: 16 KFFVKRLTTPYRRRTQMHLLVSTSRPASSWRRGFRGKQ 53 >SB_17746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 407 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/45 (26%), Positives = 21/45 (46%) Frame = -1 Query: 601 PA*ASLCLRVSMSLAETSGAATSRSQTTHLTCLCTAFTIQLILGS 467 P A + +S+ + T+G SR T + C C + L +G+ Sbjct: 190 PNGAQETIAISLPIDNTTGLTASRGYTIRIECYCIEPNVMLTMGT 234 >SB_4670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1012 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/45 (26%), Positives = 21/45 (46%) Frame = -1 Query: 601 PA*ASLCLRVSMSLAETSGAATSRSQTTHLTCLCTAFTIQLILGS 467 P A + +S+ + T+G SR T + C C + L +G+ Sbjct: 302 PNGAQETIAISIPIDNTTGLTASRGYTIRIECYCIDTNVMLTMGT 346 >SB_4188| Best HMM Match : 7tm_1 (HMM E-Value=9e-06) Length = 522 Score = 28.3 bits (60), Expect = 7.1 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = +3 Query: 219 IQNPCATWWPQATVAKGATYGKPKSHGVNQLKPTRNLKSIAEE 347 +++ C + Q+ +K +TY K HG+++ R K+ E+ Sbjct: 230 VEDACNQTYNQSLTSKTSTYCKTNKHGIHETITHRRYKNFDEQ 272 >SB_16274| Best HMM Match : PKD (HMM E-Value=3.5) Length = 351 Score = 28.3 bits (60), Expect = 7.1 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = -1 Query: 580 LRVSMSLAETSGAATSRSQTTHLTCLCTAFTIQLILGS 467 + +S+ + T+G SR T + C C + L +G+ Sbjct: 71 IAISLPIDNTTGLTASRGYTVRIGCYCIDSNVMLTMGT 108 >SB_10146| Best HMM Match : Collagen (HMM E-Value=0.09) Length = 536 Score = 28.3 bits (60), Expect = 7.1 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -1 Query: 580 LRVSMSLAETSGAATSRSQTTHLTCLCTAFTIQLILGS 467 + +S+ + T+G SR TT + C C L +G+ Sbjct: 364 IAISLPIDNTTGLTASRGYTTRIECYCIDPNAMLTMGT 401 >SB_53390| Best HMM Match : Pox_A32 (HMM E-Value=0.14) Length = 498 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/45 (26%), Positives = 21/45 (46%) Frame = -1 Query: 601 PA*ASLCLRVSMSLAETSGAATSRSQTTHLTCLCTAFTIQLILGS 467 P A + +S+ + T+G SR T + C C + L +G+ Sbjct: 287 PNGAQETIAISLPIDNTTGLTASRGYTIRIECYCIDPNVMLTMGT 331 >SB_36474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1608 Score = 27.9 bits (59), Expect = 9.4 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = +3 Query: 543 APEVSARDIDTLKQREAHAGQLGSDATLFNYVANDK-HLSKTVSDFPFAYFLY 698 APE+S I + Q+ A +G+ A Y+A+ K HL FP+ + Y Sbjct: 1176 APELSDYYIPSKTQKNAELAYIGAGALAIGYIASPKLHLGGL---FPYCAYTY 1225 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,704,924 Number of Sequences: 59808 Number of extensions: 505036 Number of successful extensions: 1247 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1145 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1247 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2046258890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -