BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00416 (754 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U88168-3|AAC24397.1| 204|Caenorhabditis elegans Ribosomal prote... 103 1e-22 AL117202-13|CAB55075.1| 580|Caenorhabditis elegans Hypothetical... 29 2.7 >U88168-3|AAC24397.1| 204|Caenorhabditis elegans Ribosomal protein, large subunitprotein 15 protein. Length = 204 Score = 103 bits (248), Expect = 1e-22 Identities = 42/59 (71%), Positives = 53/59 (89%) Frame = +1 Query: 37 MGAYRYIQELYRKKLSDVMRFLLRVRVWQYRQLTRMHRAPRPTRPDKARRLGYRAKQGY 213 MGAY+Y+QE++RKK SD +R+LLR+R W YRQL+ +HR PRPTRP+KARRLGYRAKQG+ Sbjct: 1 MGAYKYMQEIWRKKQSDALRYLLRIRTWHYRQLSAVHRVPRPTRPEKARRLGYRAKQGF 59 Score = 95.9 bits (228), Expect = 3e-20 Identities = 40/77 (51%), Positives = 55/77 (71%) Frame = +3 Query: 258 VAKGATYGKPKSHGVNQLKPTRNLKSIAEEXXXXXXXXXXXXSSYWVAQDSSYKYFEVIL 437 V KG TYGKPK+HGVN+LK ++ +++AE +SYWVA+DS+YK++EV+L Sbjct: 75 VCKGQTYGKPKTHGVNELKNAKSKQAVAEGRAGRRLGSLRVLNSYWVAEDSTYKFYEVVL 134 Query: 438 VDPSHKAIRRDPKINWI 488 +DP HKAIRR+P WI Sbjct: 135 IDPFHKAIRRNPDTQWI 151 Score = 65.3 bits (152), Expect = 4e-11 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = +2 Query: 509 REMRGLTSAGRSSRGLGKGHRYSQTKGGSRRAAWLRRNTLQLRRKR 646 RE RGLTSAGR SRGLGKG R+S T+GGS+ W R+NT RKR Sbjct: 159 REQRGLTSAGRKSRGLGKGWRFSATRGGSQAKNWKRKNTKVFHRKR 204 >AL117202-13|CAB55075.1| 580|Caenorhabditis elegans Hypothetical protein Y47D3A.16 protein. Length = 580 Score = 29.5 bits (63), Expect = 2.7 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = -2 Query: 186 SSGFVRPCGPGSAVHTS---QLTVLPYPHTQQKTHNIAQFFPIQLLNISVGTH 37 S+ RP GS+ T V+ PHT T N F + LLN+S+ H Sbjct: 526 STTTTRPSNVGSSASTPIPLPKRVIKLPHTHTSTQNAQYSFMLLLLNVSLFFH 578 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,887,707 Number of Sequences: 27780 Number of extensions: 345102 Number of successful extensions: 844 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 801 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 844 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1788025660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -