BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00413 (784 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY819656-1|AAV70656.1| 56|Tribolium castaneum elongation facto... 113 2e-27 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 25 0.90 DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 24 1.6 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 23 2.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 3.6 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 3.6 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.4 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 21 8.4 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 8.4 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 8.4 >AY819656-1|AAV70656.1| 56|Tribolium castaneum elongation factor 1-alpha protein. Length = 56 Score = 113 bits (271), Expect = 2e-27 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +3 Query: 564 LQDVYKIGGIGTVPVGRVETGVLKPGTIVVFAPANITTEVKSVEMHHEALQEAVPG 731 LQDVYKIGGIGTVPVGRVETGVLKPG +VVFAPANITTEVKSVEMHHEAL EAVPG Sbjct: 1 LQDVYKIGGIGTVPVGRVETGVLKPGMVVVFAPANITTEVKSVEMHHEALPEAVPG 56 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 24.6 bits (51), Expect = 0.90 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -3 Query: 632 QHTSFN-SADGHGTNTTDFVYVLQ 564 ++ SFN +A+GHG NT+ Y Q Sbjct: 280 EYNSFNWTANGHGHNTSSHNYYAQ 303 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 23.8 bits (49), Expect = 1.6 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 Query: 719 FLESFVVHLHRFDFSSDVG 663 FLE + H RF FSS VG Sbjct: 68 FLEMTLAHHCRFKFSSSVG 86 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 677 SSDVGGGKDNNGTWFQHTSF 618 ++ V GG +NNGT H+ F Sbjct: 182 AAQVSGGNNNNGTPGGHSGF 201 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.6 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = -2 Query: 387 ESDSSWVVANLLDV*GYFLLDFLKSGLTVWWFSGIHFVYSYDELLTPRVKASK 229 +S ++ + N L V FLL K L + W G+ +YDE T V SK Sbjct: 1267 QSVFAFFMMNALFVLIVFLLTLKKDYLHIKWPFGVKTNITYDE-STQEVHISK 1318 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.6 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = -2 Query: 387 ESDSSWVVANLLDV*GYFLLDFLKSGLTVWWFSGIHFVYSYDELLTPRVKASK 229 +S ++ + N L V FLL K L + W G+ +YDE T V SK Sbjct: 1267 QSVFAFFMMNALFVLIVFLLTLKKDYLHIKWPFGVKTNITYDE-STQEVHISK 1318 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +3 Query: 588 GIGTVPVGRVETGVLKPGTIVVFAPANITTEV 683 G+G +P KP V AP +TT V Sbjct: 990 GLGLIPDNPSREDCTKPPEPVTPAPPQVTTGV 1021 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 21.4 bits (43), Expect = 8.4 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 618 ETGVLKPGTIVVFAPANITTEVKS 689 ETG ++PG I P T EV++ Sbjct: 96 ETGSIRPGVIGGSKPRVATPEVEN 119 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -1 Query: 418 CCLRAIQKWARKRQQLGCSQSS*CMRIL 335 CC A+ RQ + S+ C+R + Sbjct: 615 CCYHAVAPGTDIRQSIALSRKKKCIRYM 642 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -1 Query: 418 CCLRAIQKWARKRQQLGCSQSS*CMRIL 335 CC A+ RQ + S+ C+R + Sbjct: 507 CCYHAVAPGTDIRQSIALSRKKKCIRYM 534 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,768 Number of Sequences: 336 Number of extensions: 4776 Number of successful extensions: 16 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21168876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -